Property Summary

NCBI Gene PubMed Count 7
PubMed Score 31.49
PubTator Score 14.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -1.050 0.012
atypical teratoid / rhabdoid tumor -1.100 0.001
medulloblastoma -1.200 0.002
medulloblastoma, large-cell -2.000 0.000
invasive ductal carcinoma -1.100 0.007
ulcerative colitis 1.100 0.000

Synonym

Accession Q96LT4 Q5JSC5 Q5JSC8 Q66K52 SMSr
Symbols SMSr
HEL-177

Gene

Gene RIF (2)

PMID Text
24259670 These results indicate a primary role of SMSr in monitoring endoplasmic reticulum ceramide levels.
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAGPNQLCIRRWTTKHVAVWLKDEGFFEYVDILCNKHRLDGITLLTLTEYDLRSPPLEIKVLGDIKRLML      1 - 70
SVRKLQKIHIDVLEEMGYNSDSPMGSMTPFISALQSTDWLCNGELSHDCDGPITDLNSDQYQYMNGKNKH     71 - 140
SVRRLDPEYWKTILSCIYVFIVFGFTSFIMVIVHERVPDMQTYPPLPDIFLDSVPRIPWAFAMTEVCGMI    141 - 210
LCYIWLLVLLLHKHRSILLRRLCSLMGTVFLLRCFTMFVTSLSVPGQHLQCTGKIYGSVWEKLHRAFAIW    211 - 280
SGFGMTLTGVHTCGDYMFSGHTVVLTMLNFFVTEYTPRSWNFLHTLSWVLNLFGIFFILAAHEHYSIDVF    281 - 350
IAFYITTRLFLYYHTLANTRAYQQSRRARIWFPMFSFFECNVNGTVPNEYCWPFSKPAIMKRLIG         351 - 415
//

Text Mined References (9)

PMID Year Title
24259670 2014 Sphingomyelin synthase-related protein SMSr is a suppressor of ceramide-induced mitochondrial apoptosis.
19506037 2009 Sphingomyelin synthase-related protein SMSr controls ceramide homeostasis in the ER.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14685263 2004 Identification of a family of animal sphingomyelin synthases.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.