Property Summary

NCBI Gene PubMed Count 7
PubMed Score 34.25
PubTator Score 14.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 5.8e-04
invasive ductal carcinoma -1.100 6.7e-03
medulloblastoma -1.200 1.8e-03
medulloblastoma, large-cell -2.000 1.9e-05
osteosarcoma -1.050 1.2e-02
ulcerative colitis 1.100 1.1e-04

Gene RIF (2)

AA Sequence

MAGPNQLCIRRWTTKHVAVWLKDEGFFEYVDILCNKHRLDGITLLTLTEYDLRSPPLEIKVLGDIKRLML      1 - 70
SVRKLQKIHIDVLEEMGYNSDSPMGSMTPFISALQSTDWLCNGELSHDCDGPITDLNSDQYQYMNGKNKH     71 - 140
SVRRLDPEYWKTILSCIYVFIVFGFTSFIMVIVHERVPDMQTYPPLPDIFLDSVPRIPWAFAMTEVCGMI    141 - 210
LCYIWLLVLLLHKHRSILLRRLCSLMGTVFLLRCFTMFVTSLSVPGQHLQCTGKIYGSVWEKLHRAFAIW    211 - 280
SGFGMTLTGVHTCGDYMFSGHTVVLTMLNFFVTEYTPRSWNFLHTLSWVLNLFGIFFILAAHEHYSIDVF    281 - 350
IAFYITTRLFLYYHTLANTRAYQQSRRARIWFPMFSFFECNVNGTVPNEYCWPFSKPAIMKRLIG         351 - 415
//

Text Mined References (9)

PMID Year Title