Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q96LS8
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MESRPSGRQHASEGDGDQSPTQCAGMRSSGRSDQPYVLKGNPLLLRVRCYSGCASGSGRQLQLSVFQDLN      1 - 70
QFSHCRVWRSPALIVKGEPPWCSQQDTQSPFQTGTPLERPCFRMKLSGWELTKNAQRALGSKLQHILSLD     71 - 140
STQACGAGGPTILRPPRAP                                                       141 - 159
//

Text Mined References (4)

PMID Year Title
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.