Property Summary

NCBI Gene PubMed Count 10
PubMed Score 8.36
PubTator Score 9.99

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Gene RIF (3)

PMID Text
22820855 data indicate that CDY2 and HSFY are located within a segment of the Y chromosome that is important for sperm maturation, and are underexpressed in testicular tissue derived from men with MA
22158087 genetic association studies: Data from 4 unrelated azoospermic patients in France with Y chromosome deletions exclude HSFY1/HSF2 genes as factors in AZFb/P4 palindrome haplogroup required for spermatogenesis.
14985478 Could have an important role in human spermatogenesis.

AA Sequence

MAHVSSETQDVSPKDELTASEASTRSPLCEHTFPGDSDLRSMIEEHAFQVLSQGSLLESPSYTVCVSEPD      1 - 70
KDDDFLSLNFPRKLWKIVESDQFKSISWDENGTCIVINEELFKKEILETKAPYRIFQTDAIKSFVRQLNL     71 - 140
YGFSKIQQNFQRSAFLATFLSEEKESSVLSKLKFYYNPNFKRGYPQLLVRVKRRIGVKNASPISTLFNED    141 - 210
FNKKHFRAGANMENHNSALAAEASEESLFSASKNLNMPLTRESSVRQIIANSSVPIRSGFPPPSPSTSVG    211 - 280
PSEQIATDQHAILNQLTTIHMHSHSTYMQARGHIVNFITTTTSQYHIISPLQNGYFGLTVEPSAVPTRYP    281 - 350
LVSVNEAPYRNMLPAGNPWLQMPTIADRSAAPHSRLALQPSPLDKYHPNYN                       351 - 401
//

Text Mined References (9)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22820855 2012 Deletion or underexpression of the Y-chromosome genes CDY2 and HSFY is associated with maturation arrest in American men with nonobstructive azoospermia.
22158087 2012 HSFY genes and the P4 palindrome in the AZFb interval of the human Y chromosome are not required for spermatocyte maturation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15044259 2004 Molecular characterization of heat shock-like factor encoded on the human Y chromosome, and implications for male infertility.
14985478 2004 Characterization of HSFY, a novel AZFb gene on the Y chromosome with a possible role in human spermatogenesis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12815422 2003 The male-specific region of the human Y chromosome is a mosaic of discrete sequence classes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.