Property Summary

NCBI Gene PubMed Count 23
PubMed Score 256.84
PubTator Score 151.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
interstitial cystitis -1.100 6.8e-05
posterior fossa group B ependymoma 1.200 9.6e-08
ulcerative colitis -1.100 7.6e-06

Gene RIF (10)

AA Sequence

MDPVVLSYMDSLLRQSDVSLLDPPSWLNDHIIGFAFEYFANSQFHDCSDHVSFISPEVTQFIKCTSNPAE      1 - 70
IAMFLEPLDLPNKRVVFLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYDSHSRSNSVHAKQVAEKLEAFL     71 - 140
GRKGDKLAFVEEKAPAQQNSYDCGMYVICNTEALCQNFFRQQTESLLQLLTPAYITKKRGEWKDLITTLA    141 - 210
KK                                                                        211 - 212
//

Text Mined References (25)

PMID Year Title