Property Summary

NCBI Gene PubMed Count 14
Grant Count 3
Funding $118,732.14
PubMed Score 20.24
PubTator Score 17.94

Knowledge Summary

Patent (2,676)

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Urticaria 53 3.534 1.8
osteosarcoma 7,933

Gene RIF (7)

PMID Text
26106044 MRGX2 is related to nociception, adrenal gland secretion and mast cell degranulation. (Review)
24954276 contributes to larger and longer lasting wheal reactions to intradermally injected neuropeptides in patients with chronic urticaria
23698749 Ectopic expression of MrgX2 in rat basophilic leukemia RBL-2H3 cells and murine bone marrow mast cells renders these cells responsive to human beta-defensin for degranulation.
22069323 identified MrgX2 as a novel G protein-coupled receptor for the antibacterial peptide LL-37 and demonstrated that unlike most G protein-coupled receptors it is resistant to agonist-induced receptor phosphorylation, desensitization, and internalization.
18636314 Mas, MrgD, and MRG mediated Ang IV-stimulated AA release that was highest for Mas. While Ang III activated Mas and MrgX2, Ang II stimulated AA release via Mas and MRG.
15862286 MRGX2 amino acid substitutions may alter the interactions between MRGX2 protein and its ligand, thus, potentially led to adaptive changes of the pain-perception-related nervous system during human evolution.
12915402 cortistatin-14 shown to be a high affinity ligand for G protein coupled receptor MrgX2 which is expressed in dorsal root ganglion

AA Sequence

MDPTTPAWGTESTTVNGNDQALLLLCGKETLIPVFLILFIALVGLVGNGFVLWLLGFRMRRNAFSVYVLS      1 - 70
LAGADFLFLCFQIINCLVYLSNFFCSISINFPSFFTTVMTCAYLAGLSMLSTVSTERCLSVLWPIWYRCR     71 - 140
RPRHLSAVVCVLLWALSLLLSILEGKFCGFLFSDGDSGWCQTFDFITAAWLIFLFMVLCGSSLALLVRIL    141 - 210
CGSRGLPLTRLYLTILLTVLVFLLCGLPFGIQWFLILWIWKDSDVLFCHIHPVSVVLSSLNSSANPIIYF    211 - 280
FVGSFRKQWRLQQPILKLALQRALQDIAEVDHSEGCFRQGTPEMSRSSLV                        281 - 330
//

Text Mined References (18)

PMID Year Title
26106044 2015 The Origin, Expression, Function and Future Research Focus of a G Protein-coupled Receptor, Mas-related Gene X2 (MrgX2).
25517090 2015 Identification of a mast-cell-specific receptor crucial for pseudo-allergic drug reactions.
24954276 2014 Expression of Mas-related gene X2 on mast cells is upregulated in the skin of patients with severe chronic urticaria.
24930830 2014 Complanadine A, a selective agonist for the Mas-related G protein-coupled receptor X2.
24583173 2014 Comparative genomic analysis of eutherian Mas-related G protein-coupled receptor genes.
23698749 2013 ?-Defensins activate human mast cells via Mas-related gene X2.
22888021 2012 G protein-coupled receptors participate in cytokinesis.
22069323 2011 Mas-related gene X2 (MrgX2) is a novel G protein-coupled receptor for the antimicrobial peptide LL-37 in human mast cells: resistance to receptor phosphorylation, desensitization, and internalization.
21441599 2011 PMX-53 as a dual CD88 antagonist and an agonist for Mas-related gene 2 (MrgX2) in human mast cells.
18636314 2008 Angiotensin metabolites can stimulate receptors of the Mas-related genes family.
More...