Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.62
PubTator Score 1.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -3.366 0.000
pilocytic astrocytoma 2.400 0.000
ovarian cancer -1.700 0.000

Synonym

Accession Q96L94 Q8WUS9 Q9H844
Symbols

Gene

PDB

2ETT  

Gene RIF (1)

PMID Text
25496667 Genome-wide shRNA screening identifies SNX22, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells

AA Sequence

MLEVHIPSVGPEAEGPRQSPEKSHMVFRVEVLCSGRRHTVPRRYSEFHALHKRIKKLYKVPDFPSKRLPN      1 - 70
WRTRGLEQRRQGLEAYIQGILYLNQEVPKELLEFLRLRHFPTDPKASNWGTLREFLPGDSSSQQHQRPVL     71 - 140
SFHVDPYVCNPSPESLPNVVVNGVLQGLYSFSISPDKAQPKAACHPAPLPPMP                     141 - 193
//

Text Mined References (6)

PMID Year Title
17400918 2007 Solution structure of human sorting nexin 22.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12461558 2002 Sorting out the cellular functions of sorting nexins.