Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.62
PubTator Score 1.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 1.4e-06
Astrocytoma, Pilocytic 3081 4.9e-06
osteosarcoma 7950 2.1e-03

Expression

  Differential Expression (3)

Disease log2 FC p
Astrocytoma, Pilocytic 2.400 4.9e-06
osteosarcoma -1.109 2.1e-03
ovarian cancer -1.700 1.4e-06

Gene RIF (1)

AA Sequence

MLEVHIPSVGPEAEGPRQSPEKSHMVFRVEVLCSGRRHTVPRRYSEFHALHKRIKKLYKVPDFPSKRLPN      1 - 70
WRTRGLEQRRQGLEAYIQGILYLNQEVPKELLEFLRLRHFPTDPKASNWGTLREFLPGDSSSQQHQRPVL     71 - 140
SFHVDPYVCNPSPESLPNVVVNGVLQGLYSFSISPDKAQPKAACHPAPLPPMP                     141 - 193
//

Text Mined References (6)

PMID Year Title