Property Summary

NCBI Gene PubMed Count 9
PubMed Score 10.10
PubTator Score 12.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
atypical teratoid/rhabdoid tumor 1.100 2.2e-07
breast carcinoma 1.100 3.6e-03
intraductal papillary-mucinous neoplasm ... -1.100 9.8e-03
osteosarcoma 2.061 2.0e-04
ovarian cancer 1.700 3.3e-03

Gene RIF (4)

AA Sequence

MKLLRRAWRRRAALGLGTLALCGAALLYLARCAAEPGDPRAMSGRSPPPPAPARAAAFLAVLVASAPRAA      1 - 70
ERRSVIRSTWLARRGAPGDVWARFAVGTAGLGAEERRALEREQARHGDLLLLPALRDAYENLTAKVLAML     71 - 140
AWLDEHVAFEFVLKADDDSFARLDALLAELRAREPARRRRLYWGFFSGRGRVKPGGRWREAAWQLCDYYL    141 - 210
PYALGGGYVLSADLVHYLRLSRDYLRAWHSEDVSLGAWLAPVDVQREHDPRFDTEYRSRGCSNQYLVTHK    211 - 280
QSLEDMLEKHATLAREGRLCKREVQLRLSYVYDWSAPPSQCCQRREGIP                         281 - 329
//

Text Mined References (9)

PMID Year Title