Property Summary

NCBI Gene PubMed Count 12
PubMed Score 1.19
PubTator Score 2.01

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q96L21 Q8IUD1
Symbols RPL10_5_1358

Gene

PDB

4UG0   4V6X  

AA Sequence

MGRRPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLGGHMVSDEYEQLSSEALEAARI      1 - 70
CANKYMVKSCGRDGFHMRVRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQGTVARVHIGQVIMSIRT     71 - 140
KLQNEEHVIEALRRAKFKFPGRQKIHISKKWGFTKFNADEFEDMVAKKCLIPDGCGVKYVPSHGPLDKWR    141 - 210
VLHS                                                                      211 - 214
//

Text Mined References (13)

PMID Year Title
23636399 2013 Structures of the human and Drosophila 80S ribosome.
21630459 2011 Proteomic characterization of the human sperm nucleus.
19946888 2010 Defining the membrane proteome of NK cells.
19333399 2009 Spermatogenesis associated retrogenes are expressed in the human ovary and ovarian cancers.
19123937 2009 Comparative analysis of processed ribosomal protein pseudogenes in four mammalian genomes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12490704 2002 Functional second genes generated by retrotransposition of the X-linked ribosomal protein genes.
More...