Property Summary

NCBI Gene PubMed Count 7
PubMed Score 9.28
PubTator Score 6.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 4.1e-11
Disease Target Count Z-score Confidence
Arts syndrome 26 5.013 2.5

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.200 4.1e-11

AA Sequence

MALAALMIALGSLGLHTWQAQAVPILPLGLAPDTFDDTYVGCAEEMEEKAAPLLKEEMAHHALLRESWEA      1 - 70
AQETWEDKRRGLTLPPGFKAQNGIAIMVYTNSSNTLYWELNQAVRTGGGSRELYMRHFPFKALHFYLIRA     71 - 140
LQLLRGSGGCSRGPGEVVFRGVGSLRFEPKRLGDSVRLGQFASSSLDKAVAHRFGNATLFSLTTCFGAPI    141 - 210
QAFSVFPKEREVLIPPHEVFLVTRFSQDGAQSLVTLWSYNQTCSHFNCAYLGGEKRRGCVSAPGALGTGD    211 - 280
LHMTKRHLQQP                                                               281 - 291
//

Text Mined References (9)

PMID Year Title