Property Summary

NCBI Gene PubMed Count 6
PubMed Score 8.20
PubTator Score 4.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
diabetes mellitus 1728 1.1e-03
Disease Target Count Z-score Confidence
Sinusitis 65 3.038 1.5

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus 1.100 1.1e-03

AA Sequence

MPPLAPQLCRAVFLVPILLLLQVKPLNGSPGPKDGSQTEKTPSADQNQEQFEEHFVASSVGEMWQVVDMA      1 - 70
QQEEDQSSKTAAVHKHSFHLSFCFSLASVMVFSGGPLRRTFPNIQLCFMLTH                       71 - 122
//

Text Mined References (7)

PMID Year Title