Property Summary

NCBI Gene PubMed Count 9
PubMed Score 4.82
PubTator Score 4.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma 1.500 1.2e-04
atypical teratoid / rhabdoid tumor 1.100 1.5e-03
Breast cancer 1.100 2.0e-03
ductal carcinoma in situ 1.300 6.6e-03
ependymoma 3.200 2.1e-13
glioblastoma 1.600 1.1e-05
group 3 medulloblastoma 1.700 7.8e-05
invasive ductal carcinoma 2.300 2.2e-02
nasopharyngeal carcinoma -2.000 3.0e-05
ovarian cancer 1.200 9.1e-03

Synonym

Accession Q96L03 A5D6N2
Symbols IQCH
MSRG11
MSRG-11

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (4)

AA Sequence

MATLARLQARSSTVGNQYYFRNSVVDPFRKKENDAAVKIQSWFRGCQVRAYIRHLNRIVTIIQKWWRSFL      1 - 70
GRKQYQLTVQVAYYTMMMNLYNAMAVRIQRRWRGYRVRKYLFNYYYLKEYLKVVSETNDAIRKALEEFAE     71 - 140
MKEREEKKANLEREEKKRDYQARKMHYLLSTKQIPGIYNSPFRKEPDPWELQLQKAKPLTHRRPKVKQKD    141 - 210
STSLTDWLACTSARSFPRSEILPPINRKQCQGPFRDITEVLEQRYRPLEPTLRVAEPIDELKLAREELRR    211 - 280
EEWLQNVNDNMFLPFSSYHKNEKYIPSMHLSSKYGPISYKEQFRSENPKKWICDKDFQTVLPSFELFSKY    281 - 350
GKLYSKAGQIV                                                               351 - 361
//

Text Mined References (9)

PMID Year Title