Property Summary

NCBI Gene PubMed Count 9
PubMed Score 4.82
PubTator Score 4.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Gene RIF (4)

PMID Text
23079716 Elevated production of the SPATA17 protein disturbs the normal development of male germ cells.
19680270 Observational study of gene-disease association. (HuGE Navigator)
19483714 the frequency of the SNP3 allele was significantly elevated in the meiotic arrest group (P < 0.05). This study suggests that SPATA17 may play a critical role in human spermatogenesis, especially in meiosis.
19483714 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MATLARLQARSSTVGNQYYFRNSVVDPFRKKENDAAVKIQSWFRGCQVRAYIRHLNRIVTIIQKWWRSFL      1 - 70
GRKQYQLTVQVAYYTMMMNLYNAMAVRIQRRWRGYRVRKYLFNYYYLKEYLKVVSETNDAIRKALEEFAE     71 - 140
MKEREEKKANLEREEKKRDYQARKMHYLLSTKQIPGIYNSPFRKEPDPWELQLQKAKPLTHRRPKVKQKD    141 - 210
STSLTDWLACTSARSFPRSEILPPINRKQCQGPFRDITEVLEQRYRPLEPTLRVAEPIDELKLAREELRR    211 - 280
EEWLQNVNDNMFLPFSSYHKNEKYIPSMHLSSKYGPISYKEQFRSENPKKWICDKDFQTVLPSFELFSKY    281 - 350
GKLYSKAGQIV                                                               351 - 361
//

Text Mined References (9)

PMID Year Title
23079716 2013 Overexpression of human SPATA17 protein induces germ cell apoptosis in transgenic male mice.
19680270 2009 Identification of novel candidate loci for anorexia nervosa at 1q41 and 11q22 in Japanese by a genome-wide association analysis with microsatellite markers.
19483714 2009 A single nucleotide polymorphism in SPATA17 may be a genetic risk factor for Japanese patients with meiotic arrest.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16395525 2006 Expression and identification of a novel apoptosis gene Spata17 (MSRG-11) in mouse spermatogenic cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.