Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.20
PubTator Score 3.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
Breast cancer 3578 2.2e-58
psoriasis 6694 4.1e-17
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Melanoma 711 0.0 0.6
Disease Target Count Z-score Confidence
Male infertility 206 3.17 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
Breast cancer -2.000 2.2e-58
psoriasis -1.800 4.1e-17

Synonym

Accession Q96KX2 Q969J0
Symbols Gsg3
CAPPA3
HEL-S-86

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

AA Sequence

MTLSVLSRKDKERVIRRLLLQAPPGEFVNAFDDLCLLIRDEKLMHHQGECAGHQHCQKYSVPLCIDGNPV      1 - 70
LLSHHNVMGDYRFFDHQSKLSFKYDLLQNQLKDIQSHGIIQNEAEYLRVVLLCALKLYVNDHYPKGNCNM     71 - 140
LRKTVKSKEYLIACIEDHNYETGECWNGLWKSKWIFQVNPFLTQVTGRIFVQAHFFRCVNLHIEISKDLK    141 - 210
ESLEIVNQAQLALSFARLVEEQENKFQAAVLEELQELSNEALRKILRRDLPVTRTLIDWHRILSDLNLVM    211 - 280
YPKLGYVIYSRSVLCNWII                                                       281 - 299
//

Text Mined References (11)

PMID Year Title