Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
osteosarcoma 7,933

Expression

AA Sequence

MEPAAALHFSRPASLLLLLSLCALVSAQVTVVGPTDPILAMVGENTTLRCCLSPEENAEDMEVRWFQSQF      1 - 70
SPAVFVYKGGRERTEEQKEEYRGRTTFVSKDSRGSVALIIHNVTAEDNGIYQCYFQEGRSCNEAILHLVV     71 - 140
AGLDSEPVIEMRDHEDGGIQLECISGGWYPKPLTVWRDPYGEVVPALKEVSTPDADSLFMVTTAVIIRDK    141 - 210
SVRNVSCSINDTLLGQKKESVIFIPESFMPSRSPCVVILPVIMIILMIPIAICIYWINNLQKEKKDSHLM    211 - 280
TFNLCLSLAGWRRTFLHAANVVLDQDTGHPYLFVSEDKRSVTLDPSRESIPGNPERFDSQLCVLGQESFA    281 - 350
SGKHYLEVDVENVIEWTVGICRDNVERKWEVPLLPQNGFWTLEMHKRKYWALTSLKWILSLEEPLCQVGI    351 - 420
FLDYEAGDVSFYNMRDRSHIYTFPHSAFSVPVRPFFSLGSYDSQILICSAFTGASGVTVPEEGWTLHRAG    421 - 490
THHSPQNQFPSLTAMETSPGHLSSHCTMPLVEDTPSSPLVTQENIFQLPLSHPLQTSAPVHLLIRCGFSS    491 - 560
SFGCNYGMESRHRELVVPQLPARKKV                                                561 - 586
//

Text Mined References (6)

PMID Year Title
20208008 2010 BTN1A1, the mammary gland butyrophilin, and BTN2A2 are both inhibitors of T cell activation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11170752 2001 The cluster of BTN genes in the extended major histocompatibility complex.