Property Summary

NCBI Gene PubMed Count 21
PubMed Score 262.55
PubTator Score 230.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Diabetic Nephropathies 37 0.0 0.0
Fatty Liver 70 0.0 0.0
Disease Target Count
Diabetic Nephropathy 34
Disease Target Count P-value
juvenile dermatomyositis 1187 1.5e-11
tuberculosis 2010 3.2e-04
osteosarcoma 7950 7.5e-04
ovarian cancer 8520 1.4e-03
Multiple myeloma 1332 1.3e-02
astrocytoma 1146 3.2e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Refractive error 50 0.0 2.4
Disease Target Count Z-score Confidence
Cancer 2499 3.906 2.0
Bilirubin metabolic disorder 41 3.466 1.7

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytoma 1.100 3.2e-02
juvenile dermatomyositis 1.080 1.5e-11
Multiple myeloma 1.004 1.3e-02
osteosarcoma 1.370 7.5e-04
ovarian cancer 2.000 1.4e-03
tuberculosis 1.200 3.2e-04

Gene RIF (11)

AA Sequence

MAALTTLFKYIDENQDRYIKKLAKWVAIQSVSAWPEKRGEIRRMMEVAAADVKQLGGSVELVDIGKQKLP      1 - 70
DGSEIPLPPILLGRLGSDPQKKTVCIYGHLDVQPAALEDGWDSEPFTLVERDGKLYGRGSTDDKGPVAGW     71 - 140
INALEAYQKTGQEIPVNVRFCLEGMEESGSEGLDELIFARKDTFFKDVDYVCISDNYWLGKKKPCITYGL    141 - 210
RGICYFFIEVECSNKDLHSGVYGGSVHEAMTDLILLMGSLVDKRGNILIPGINEAVAAVTEEEHKLYDDI    211 - 280
DFDIEEFAKDVGAQILLHSHKKDILMHRWRYPSLSLHGIEGAFSGSGAKTVIPRKVVGKFSIRLVPNMTP    281 - 350
EVVGEQVTSYLTKKFAELRSPNEFKVYMGHGGKPWVSDFSHPHYLAGRRAMKTVFGVEPDLTREGGSIPV    351 - 420
TLTFQEATGKNVMLLPVGSADDGAHSQNEKLNRYNYIEGTKMLAAYLYEVSQLKD                   421 - 475
//

Text Mined References (30)

PMID Year Title