Property Summary

NCBI Gene PubMed Count 20
Grant Count 6
R01 Count 3
Funding $525,775.76
PubMed Score 235.38
PubTator Score 230.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Multiple myeloma 1.004 0.013
osteosarcoma 1.370 0.001
astrocytoma 1.100 0.032
juvenile dermatomyositis 1.080 0.000
tuberculosis 1.200 0.000
ovarian cancer 2.000 0.001

Synonym

Accession Q96KP4 B3KUG4 Q8WY59 Q9BQ94 Q9NVB4 V9HWE5
Symbols CN2
CPGL
PEPA
HsT2298
HEL-S-13

Gene

PANTHER Protein Class (3)

PDB

4RUH  

Gene RIF (10)

PMID Text
25964343 To identify substrates of orphan transporter ATP-binding cassette subfamily C member 5 (ABCC5), identified a class of metabolites, N-lactoyl-amino acids, and found that a protease, cytosolic nonspecific dipeptidase 2 (CNDP2), catalyzes their formation.
24885395 Expression of CN2 in clinical colon tumors and colon cancer cell lines was significantly higher than that in normal colon mucosa cell lines. Knockdown of CNDP2 can inhibit the proliferation of colon cancer in vitro and retarded carcinogenesis in vivo.
24395568 Results suggest that CNDP2 acts as a functional tumor suppressor in gastric cancer via activation of the mitogen-activated protein kinase (MAPK) pathway.
22410244 a key role of CNDP2 in PD neurodegeneration, by mechanisms that could involve oxidative stress, protein aggregation or inflammation.
22128300 deletion of the CPGL gene is a poor prognostic marker in resected pancreatic cancer, and functional studies suggest the CPGL gene as growth suppressor gene in pancreatic cancer.
21573905 Common variants in CNDP1 and CNDP2 play a role in susceptibility to kidney disease in patients with type 2 diabetes.
20199107 the crystal structure of the flop-selective allosteric modulator, PEPA, bound to the binding domains of the GluA2 and GluA3 flop isoforms of AMPA receptors
19373489 Observational study of gene-disease association. (HuGE Navigator)
18753673 Our large, comprehensive study did not find an association between the D18S880 microsatellite or any other polymorphisms in the CNDP2-CNDP1 genomic region and susceptibility for diabetic nephropathy in type 1 diabetes
18753673 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAALTTLFKYIDENQDRYIKKLAKWVAIQSVSAWPEKRGEIRRMMEVAAADVKQLGGSVELVDIGKQKLP      1 - 70
DGSEIPLPPILLGRLGSDPQKKTVCIYGHLDVQPAALEDGWDSEPFTLVERDGKLYGRGSTDDKGPVAGW     71 - 140
INALEAYQKTGQEIPVNVRFCLEGMEESGSEGLDELIFARKDTFFKDVDYVCISDNYWLGKKKPCITYGL    141 - 210
RGICYFFIEVECSNKDLHSGVYGGSVHEAMTDLILLMGSLVDKRGNILIPGINEAVAAVTEEEHKLYDDI    211 - 280
DFDIEEFAKDVGAQILLHSHKKDILMHRWRYPSLSLHGIEGAFSGSGAKTVIPRKVVGKFSIRLVPNMTP    281 - 350
EVVGEQVTSYLTKKFAELRSPNEFKVYMGHGGKPWVSDFSHPHYLAGRRAMKTVFGVEPDLTREGGSIPV    351 - 420
TLTFQEATGKNVMLLPVGSADDGAHSQNEKLNRYNYIEGTKMLAAYLYEVSQLKD                   421 - 475
//

Text Mined References (29)

PMID Year Title
25964343 2015 N-lactoyl-amino acids are ubiquitous metabolites that originate from CNDP2-mediated reverse proteolysis of lactate and amino acids.
24885395 2014 Up-regulation of CNDP2 facilitates the proliferation of colon cancer.
24395568 2014 Underexpressed CNDP2 participates in gastric cancer growth inhibition through activating the MAPK signaling pathway.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23396134 2013 Genome-wide meta-analyses of multiancestry cohorts identify multiple new susceptibility loci for refractive error and myopia.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22410244 2012 Proteomic profiling of the substantia nigra demonstrates CNDP2 overexpression in Parkinson's disease.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
More...