Property Summary

NCBI Gene PubMed Count 42
Grant Count 32
R01 Count 17
Funding $2,033,076.67
PubMed Score 48.45
PubTator Score 47.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus -1.200 0.001
sonic hedgehog group medulloblastoma 1.400 0.000

Gene RIF (19)

PMID Text
26359301 data suggest that the induction of SGK1 through treatment with dexamethasone alters MT dynamics to increase Sec5-GEF-H1 interactions, which promote GEF-H1 targeting to adhesion sites.
26350970 HIV-1 Nef-mediated actin rearrangement is inhibited by EXOC2
26350970 HIV-1 Nef-mediated actin rearrangement is inhibited by EXOC2
26350970 HIV-1 Nef-mediated actin rearrangement is inhibited by EXOC2
26350970 HIV-1 Nef-mediated actin rearrangement is inhibited by EXOC2
23844030 Exocyst sec5 regulates exocytosis of newcomer insulin granules underlying biphasic insulin secretion.
22761837 We identified interactions between RalA and its effectors sec5 and exo84 in the Exocyst complex as directly necessary for migration and invasion of prostate cancer tumor cells.
22534017 HIV-1 Nef-mediated actin rearrangement is inhibited by EXOC2
22534017 HIV-1 Nef-mediated actin rearrangement is inhibited by EXOC2
21197618 Data show that Mc1R, HERC2, IRF4, TYR and EXOC2 are ranked highest in hair color prediction analysis.
More...

AA Sequence

MSRSRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKND      1 - 70
KGDIIVTTKSGGRGTSTVSFKLLKPEKIGILDQSAVWVDEMNYYDMRTDRNKGIPPLSLRPANPLGIEIE     71 - 140
KSKFSQKDLEMLFHGMSADFTSENFSAAWYLIENHSNTSFEQLKMAVTNLKRQANKKSEGSLAYVKGGLS    141 - 210
TFFEAQDALSAIHQKLEADGTEKVEGSMTQKLENVLNRASNTADTLFQEVLGRKDKADSTRNALNVLQRF    211 - 280
KFLFNLPLNIERNIQKGDYDVVINDYEKAKSLFGKTEVQVFKKYYAEVETRIEALRELLLDKLLETPSTL    281 - 350
HDQKRYIRYLSDLHASGDPAWQCIGAQHKWILQLMHSCKEGYVKDLKGNPGLHSPMLDLDNDTRPSVLGH    351 - 420
LSQTASLKRGSSFQSGRDDTWRYKTPHRVAFVEKLTKLVLSQLPNFWKLWISYVNGSLFSETAEKSGQIE    421 - 490
RSKNVRQRQNDFKKMIQEVMHSLVKLTRGALLPLSIRDGEAKQYGGWEVKCELSGQWLAHAIQTVRLTHE    491 - 560
SLTALEIPNDLLQTIQDLILDLRVRCVMATLQHTAEEIKRLAEKEDWIVDNEGLTSLPCQFEQCIVCSLQ    561 - 630
SLKGVLECKPGEASVFQQPKTQEEVCQLSINIMQVFIYCLEQLSTKPDADIDTTHLSVDVSSPDLFGSIH    631 - 700
EDFSLTSEQRLLIVLSNCCYLERHTFLNIAEHFEKHNFQGIEKITQVSMASLKELDQRLFENYIELKADP    701 - 770
IVGSLEPGIYAGYFDWKDCLPPTGVRNYLKEALVNIIAVHAEVFTISKELVPRVLSKVIEAVSEELSRLM    771 - 840
QCVSSFSKNGALQARLEICALRDTVAVYLTPESKSSFKQALEALPQLSSGADKKLLEELLNKFKSSMHLQ    841 - 910
LTCFQAASSTMMKT                                                            911 - 924
//

Text Mined References (46)

PMID Year Title
26359301 2015 Dexamethasone-induced cellular tension requires a SGK1-stimulated Sec5-GEF-H1 interaction.
25261932 2014 Genome-wide association study identifies multiple susceptibility loci for diffuse large B cell lymphoma.
25241763 2014 Meta-analysis of genome-wide association studies identifies novel loci that influence cupping and the glaucomatous process.
24056301 2013 The deubiquitylase USP33 discriminates between RALB functions in autophagy and innate immune response.
23844030 2013 Exocyst sec5 regulates exocytosis of newcomer insulin granules underlying biphasic insulin secretion.
23548203 2013 Genome-wide association studies identify several new loci associated with pigmentation traits and skin cancer risk in European Americans.
23470693 2013 Genome-wide association studies of pit-and-fissure- and smooth-surface caries in permanent dentition.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23064961 2013 GWAS of dental caries patterns in the permanent dentition.
22885689 2012 Genome-wide association study of multiplex schizophrenia pedigrees.
More...