Property Summary

NCBI Gene PubMed Count 6
Grant Count 26
R01 Count 8
Funding $5,898,275
PubMed Score 16.07
PubTator Score 4.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -1.200 0.005
oligodendroglioma -1.100 0.005
primary pancreatic ductal adenocarcinoma -1.237 0.003
intraductal papillary-mucinous neoplasm ... -1.200 0.006
ductal carcinoma in situ -2.600 0.001
invasive ductal carcinoma -2.700 0.009
pancreatic cancer -1.100 0.006
psoriasis -1.200 0.000

AA Sequence

MGLSPGAEGEYALRLPRIPPPLPKPASRTASTGPKDQPPALRRSAVPHSGLNSISPLELEESVGFAALVQ      1 - 70
LPAKQPPPGTLEQGRSIQQGEKAVVSLETTPSQKADWSSIPKPENEGKLIKQAAEGKPRPRPGDLIEIFR     71 - 140
IGYEHWAIYVEDDCVVHLAPPSEEFEVGSITSIFSNRAVVKYSRLEDVLHGCSWKVNNKLDGTYLPLPVD    141 - 210
KIIQRTKKMVNKIVQYSLIEGNCEHFVNGLRYGVPRSQQVEHALMEGAKAAGAVISAVVDSIKPKPITA     211 - 279
//

Text Mined References (7)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
19000777 2009 cDNA cloning and characterization of human and mouse Ca(2+)-independent phosphatidylethanolamine N-acyltransferases.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17158102 2007 Discovery and characterization of a Ca2+-independent phosphatidylethanolamine N-acyltransferase generating the anandamide precursor and its congeners.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.