Property Summary

NCBI Gene PubMed Count 6
PubMed Score 18.27
PubTator Score 4.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -1.200 4.7e-03
ductal carcinoma in situ -2.600 1.4e-03
intraductal papillary-mucinous neoplasm ... -1.200 6.2e-03
invasive ductal carcinoma -2.700 8.6e-03
oligodendroglioma -1.100 5.2e-03
pancreatic cancer -1.100 6.3e-03
primary pancreatic ductal adenocarcinoma -1.237 3.0e-03
psoriasis -1.200 8.9e-23

AA Sequence

MGLSPGAEGEYALRLPRIPPPLPKPASRTASTGPKDQPPALRRSAVPHSGLNSISPLELEESVGFAALVQ      1 - 70
LPAKQPPPGTLEQGRSIQQGEKAVVSLETTPSQKADWSSIPKPENEGKLIKQAAEGKPRPRPGDLIEIFR     71 - 140
IGYEHWAIYVEDDCVVHLAPPSEEFEVGSITSIFSNRAVVKYSRLEDVLHGCSWKVNNKLDGTYLPLPVD    141 - 210
KIIQRTKKMVNKIVQYSLIEGNCEHFVNGLRYGVPRSQQVEHALMEGAKAAGAVISAVVDSIKPKPITA     211 - 279
//

Text Mined References (7)

PMID Year Title