Property Summary

NCBI Gene PubMed Count 6
PubMed Score 16.07
PubTator Score 4.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 8.94553651446677E-23
ductal carcinoma in situ 1745 0.00143937362831262
primary pancreatic ductal adenocarcinoma 1271 0.00295819407490753
astrocytic glioma 2241 0.00465351383609839
oligodendroglioma 2849 0.00521955695748325
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00624643877276404
pancreatic cancer 2300 0.00625891243568107
invasive ductal carcinoma 2950 0.00855913848343589
Disease Target Count Z-score Confidence
Poland syndrome 7 5.77 2.9

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -1.200 0.005
oligodendroglioma -1.100 0.005
primary pancreatic ductal adenocarcinoma -1.237 0.003
intraductal papillary-mucinous neoplasm ... -1.200 0.006
ductal carcinoma in situ -2.600 0.001
invasive ductal carcinoma -2.700 0.009
pancreatic cancer -1.100 0.006
psoriasis -1.200 0.000

AA Sequence

MGLSPGAEGEYALRLPRIPPPLPKPASRTASTGPKDQPPALRRSAVPHSGLNSISPLELEESVGFAALVQ      1 - 70
LPAKQPPPGTLEQGRSIQQGEKAVVSLETTPSQKADWSSIPKPENEGKLIKQAAEGKPRPRPGDLIEIFR     71 - 140
IGYEHWAIYVEDDCVVHLAPPSEEFEVGSITSIFSNRAVVKYSRLEDVLHGCSWKVNNKLDGTYLPLPVD    141 - 210
KIIQRTKKMVNKIVQYSLIEGNCEHFVNGLRYGVPRSQQVEHALMEGAKAAGAVISAVVDSIKPKPITA     211 - 279
//

Text Mined References (7)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
19000777 2009 cDNA cloning and characterization of human and mouse Ca(2+)-independent phosphatidylethanolamine N-acyltransferases.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17158102 2007 Discovery and characterization of a Ca2+-independent phosphatidylethanolamine N-acyltransferase generating the anandamide precursor and its congeners.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.