Property Summary

NCBI Gene PubMed Count 24
Grant Count 18
R01 Count 12
Funding $1,963,756.13
PubMed Score 19.83
PubTator Score 16.25

Knowledge Summary

Patent

No data available

Expression

Gene RIF (14)

PMID Text
25044114 results indicate that myogenin is a positive regulator in transcriptional regulation of MEGF10 in skeletal muscle
22371254 Megf10 is required for preserving the undifferentiated, proliferative potential of satellite cells, myogenic precursors that regenerate skeletal muscle in response to injury or disease.
22371254 Mutations in MEGF10 cause a recessive congenital myopathy with minicores and suggest satellite cell dysfunction as the pathogenic mechanism
22101682 Mutations in MEGF10, a regulator of satellite cell myogenesis, cause early onset myopathy, areflexia, respiratory distress and dysphagia (EMARDD)
20828568 MEGF10 is involved in the uptake of amyloid-beta peptide (Abeta42) in the brain.
20813413 The results of this study suggested that no association between schizophrenia and rs27388 of the MEGF10 gene in Chinese case-control sample.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19721717 Observational study of gene-disease association. (HuGE Navigator)
19197986 Observational study of gene-disease association. (HuGE Navigator)
18179784 In expression studies, MEGF10 had higher expression levels in the affected than the unaffected (p = .015). Schizophrenia patients with a 1/1 genotype at rs27388 had higher expressions than those patients with 1/2 and 2/2 genotypes (p = .0008).
More...

AA Sequence

MVISLNSCLSFICLLLCHWIGTASPLNLEDPNVCSHWESYSVTVQESYPHPFDQIYYTSCTDILNWFKCT      1 - 70
RHRVSYRTAYRHGEKTMYRRKSQCCPGFYESGEMCVPHCADKCVHGRCIAPNTCQCEPGWGGTNCSSACD     71 - 140
GDHWGPHCTSRCQCKNGALCNPITGACHCAAGFRGWRCEDRCEQGTYGNDCHQRCQCQNGATCDHVTGEC    141 - 210
RCPPGYTGAFCEDLCPPGKHGPQCEQRCPCQNGGVCHHVTGECSCPSGWMGTVCGQPCPEGRFGKNCSQE    211 - 280
CQCHNGGTCDAATGQCHCSPGYTGERCQDECPVGTYGVLCAETCQCVNGGKCYHVSGACLCEAGFAGERC    281 - 350
EARLCPEGLYGIKCDKRCPCHLENTHSCHPMSGECACKPGWSGLYCNETCSPGFYGEACQQICSCQNGAD    351 - 420
CDSVTGKCTCAPGFKGIDCSTPCPLGTYGINCSSRCGCKNDAVCSPVDGSCTCKAGWHGVDCSIRCPSGT    421 - 490
WGFGCNLTCQCLNGGACNTLDGTCTCAPGWRGEKCELPCQDGTYGLNCAERCDCSHADGCHPTTGHCRCL    491 - 560
PGWSGVHCDSVCAEGRWGPNCSLPCYCKNGASCSPDDGICECAPGFRGTTCQRICSPGFYGHRCSQTCPQ    561 - 630
CVHSSGPCHHITGLCDCLPGFTGALCNEVCPSGRFGKNCAGICTCTNNGTCNPIDRSCQCYPGWIGSDCS    631 - 700
QPCPPAHWGPNCIHTCNCHNGAFCSAYDGECKCTPGWTGLYCTQRCPLGFYGKDCALICQCQNGADCDHI    701 - 770
SGQCTCRTGFMGRHCEQKCPSGTYGYGCRQICDCLNNSTCDHITGTCYCSPGWKGARCDQAGVIIVGNLN    771 - 840
SLSRTSTALPADSYQIGAIAGIIILVLVVLFLLALFIIYRHKQKGKESSMPAVTYTPAMRVVNADYTISG    841 - 910
TLPHSNGGNANSHYFTNPSYHTLTQCATSPHVNNRDRMTVTKSKNNQLFVNLKNVNPGKRGPVGDCTGTL    911 - 980
PADWKHGGYLNELGAFGLDRSYMGKSLKDLGKNSEYNSSNCSLSSSENPYATIKDPPVLIPKSSECGYVE    981 - 1050
MKSPARRDSPYAEINNSTSANRNVYEVEPTVSVVQGVFSNNGRLSQDPYDLPKNSHIPCHYDLLPVRDSS   1051 - 1120
SSPKQEDSGGSSSNSSSSSE                                                     1121 - 1140
//

Text Mined References (26)

PMID Year Title
27170117 2016 Megf10 Is a Receptor for C1Q That Mediates Clearance of Apoptotic Cells by Astrocytes.
25044114 2014 Myogenin is a positive regulator of MEGF10 expression in skeletal muscle.
23954233 2013 Cysteine mutations cause defective tyrosine phosphorylation in MEGF10 myopathy.
23535033 2014 Genome-wide association study of the rate of cognitive decline in Alzheimer's disease.
23453856 2013 Novel SNP array analysis and exome sequencing detect a homozygous exon 7 deletion of MEGF10 causing early onset myopathy, areflexia, respiratory distress and dysphagia (EMARDD).
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
22993420 2012 Jedi-1 and MEGF10 signal engulfment of apoptotic neurons through the tyrosine kinase Syk.
22407321 2012 MEGF10 and MEGF11 mediate homotypic interactions required for mosaic spacing of retinal neurons.
22371254 2012 Mutations in the satellite cell gene MEGF10 cause a recessive congenital myopathy with minicores.
22101682 2011 Mutations in MEGF10, a regulator of satellite cell myogenesis, cause early onset myopathy, areflexia, respiratory distress and dysphagia (EMARDD).
More...