Property Summary

NCBI Gene PubMed Count 14
PubMed Score 8.41
PubTator Score 7.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
Breast cancer 1.200 5.6e-06
acute quadriplegic myopathy 1.743 6.8e-07
Astrocytoma, Pilocytic 1.300 5.5e-04
atypical teratoid / rhabdoid tumor 1.500 7.9e-04
autosomal dominant Emery-Dreifuss muscul... 1.006 2.0e-03
ependymoma 1.300 2.7e-05
glioblastoma 1.600 6.8e-07
intraductal papillary-mucinous adenoma (... 1.100 2.7e-03
invasive ductal carcinoma 1.300 1.9e-02
juvenile dermatomyositis 1.351 1.2e-11
malignant mesothelioma -1.900 1.6e-07
osteosarcoma 1.008 2.0e-02
ovarian cancer -1.200 3.4e-06
pediatric high grade glioma 1.100 3.4e-03
Pick disease 1.300 5.6e-07
pituitary cancer -1.200 7.0e-03
primitive neuroectodermal tumor 1.200 3.9e-02
subependymal giant cell astrocytoma 1.031 3.0e-02

Gene RIF (3)

AA Sequence

MTAPCSQPAQLPGRRQLGLVPFPPPPPRTPLLWLLLLLLAAVAPARGWESGDLELFDLVEEVQLNFYQFL      1 - 70
GVQQDASSADIRKAYRKLSLTLHPDKNKDENAETQFRQLVAIYEVLKDDERRQRYDDILINGLPDWRQPV     71 - 140
FYYRRVRKMSNAELALLLFIILTVGHYAVVWSIYLEKQLDELLSRKKREKKKKTGSKSVDVSKLGASEKN    141 - 210
ERLLMKPQWHDLLPCKLGIWFCLTLKALPHLIQDAGQFYAKYKETRLKEKEDALTRTELETLQKQKKVKK    211 - 280
PKPEFPVYTPLETTYIQSYDHGTSIEEIEEQMDDWLENRNRTQKKQAPEWTEEDLSQLTRSMVKFPGGTP    281 - 350
GRWEKIAHELGRSVTDVTTKAKQLKDSVTCSPGMVRLSELKSTVQNSRPIKTATTLPDDMITQREDAEGV    351 - 420
AAEEEQEGDSGEQETGATDARPRRRKPARLLEATAKPEPEEKSRAKRQKDFDIAEQNESSDEESLRKERA    421 - 490
RSAEEPWTQNQQKLLELALQQYPRGSSDRWDKIARCVPSKSKEDCIARYKLLVELVQKKKQAKS          491 - 554
//

Text Mined References (23)

PMID Year Title