Property Summary

NCBI Gene PubMed Count 13
PubMed Score 8.37
PubTator Score 7.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Melanoma 261
Disease Target Count P-value
juvenile dermatomyositis 1189 1.23054980647653E-11
malignant mesothelioma 3163 1.55320007716667E-7
Pick disease 1893 5.61419043109921E-7
glioblastoma 5572 6.45821868745471E-7
acute quadriplegic myopathy 1157 6.76688873487684E-7
posterior fossa group A ependymoma 1511 3.97146056519127E-6
atypical teratoid / rhabdoid tumor 4369 4.93231091777372E-5
pilocytic astrocytoma 3086 5.16692793930755E-4
ovarian cancer 8492 5.92826647416657E-4
primitive neuroectodermal tumor 3031 6.55942953209921E-4
pituitary cancer 1972 9.49717163547752E-4
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00201766527838884
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00273545469004045
pediatric high grade glioma 2712 0.0033715682874408
osteosarcoma 7933 0.00377483925267412
invasive ductal carcinoma 2950 0.0130520329197933
subependymal giant cell astrocytoma 2287 0.0303704918060978
Disease Target Count Z-score Confidence
Asthma 349 0.0 1.0
Breast cancer 3099 0.0 2.0
Parkinson's disease 364 0.0 2.0

Expression

Synonym

Accession Q96KC8 B0YIZ8 Q5VX89 Q9H6B8
Symbols HTJ1
MTJ1
ERdj1
DNAJL1

Gene

PDB

2CQQ   2CQR  

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid

Gene RIF (2)

PMID Text
16385451 Observational study of gene-disease association. (HuGE Navigator)
16271702 ITIH4 and MTJ1 co-immunoprecipitate from total liver protein extracts and SANT domain of HTJ1 protects the ITIH4(588-930) recombinant fragment

AA Sequence

MTAPCSQPAQLPGRRQLGLVPFPPPPPRTPLLWLLLLLLAAVAPARGWESGDLELFDLVEEVQLNFYQFL      1 - 70
GVQQDASSADIRKAYRKLSLTLHPDKNKDENAETQFRQLVAIYEVLKDDERRQRYDDILINGLPDWRQPV     71 - 140
FYYRRVRKMSNAELALLLFIILTVGHYAVVWSIYLEKQLDELLSRKKREKKKKTGSKSVDVSKLGASEKN    141 - 210
ERLLMKPQWHDLLPCKLGIWFCLTLKALPHLIQDAGQFYAKYKETRLKEKEDALTRTELETLQKQKKVKK    211 - 280
PKPEFPVYTPLETTYIQSYDHGTSIEEIEEQMDDWLENRNRTQKKQAPEWTEEDLSQLTRSMVKFPGGTP    281 - 350
GRWEKIAHELGRSVTDVTTKAKQLKDSVTCSPGMVRLSELKSTVQNSRPIKTATTLPDDMITQREDAEGV    351 - 420
AAEEEQEGDSGEQETGATDARPRRRKPARLLEATAKPEPEEKSRAKRQKDFDIAEQNESSDEESLRKERA    421 - 490
RSAEEPWTQNQQKLLELALQQYPRGSSDRWDKIARCVPSKSKEDCIARYKLLVELVQKKKQAKS          491 - 554
//

Text Mined References (22)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23535730 2013 GWAS meta-analysis and replication identifies three new susceptibility loci for ovarian cancer.
23535729 2013 Large-scale genotyping identifies 41 new loci associated with breast cancer risk.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
More...