Property Summary

NCBI Gene PubMed Count 15
Grant Count 40
R01 Count 32
Funding $5,784,331.95
PubMed Score 1.90
PubTator Score 66.18

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -4.029 0.000
interstitial cystitis 1.200 0.008
acute myeloid leukemia 1.200 0.005
psoriasis 1.500 0.000

Gene RIF (11)

PMID Text
26248046 pro-inflammatory stimuli lead to FPR2/ALX expression while LXA4 induces an anti-inflammatory response
24166736 LXA decreased IgM and IgG production on activated human B cells through ALX/FPR2-dependent signaling.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20471366 although ALX is inducibly phosphorylated upon TCR/CD28 stimulation, this phosphorylation is not required for ALX to inhibit T cell activation.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20080636 results indicate that RvD1 specifically interacts with both ALX and GPR32 on phagocytes.
19913121 Observational study of gene-disease association. (HuGE Navigator)
16169852 ALX exerts its effect on IL-2 up-regulation in the cytoplasm and responds to TCR and CD28 signaling
15284240 the ALX SH2 domain plays a critical role in ALX function downstream of CD28
12960172 ALX is an adaptor involved in T cell activation and interleukin-2 (IL-2) promoter activation
More...

AA Sequence

MTEAGKLPLPLPPRLDWFVHTQMGQLAQDGVPEWFHGAISREDAENLLESQPLGSFLIRVSHSHVGYTLS      1 - 70
YKAQSSCCHFMVKLLDDGTFMIPGEKVAHTSLDALVTFHQQKPIEPRRELLTQPCRQKDPANVDYEDLFL     71 - 140
YSNAVAEEAACPVSAPEEASPKPVLCHQSKERKPSAEMNRITTKEATSSCPPKSPLGETRQKLWRSLKML    141 - 210
PERGQRVRQQLKSHLATVNLSSLLDVRRSTVISGPGTGKGSQDHSGDPTSGDRGYTDPCVATSLKSPSQP    211 - 280
QAPKDRKVPTRKAERSVSCIEVTPGDRSWHQMVVRALSSQESKPEHQGLAEPENDQLPEEYQQPPPFAPG    281 - 350
YC                                                                        351 - 352
//

Text Mined References (16)

PMID Year Title
26248046 2015 Differential regulation of monocytic expression of leukotriene and lipoxin receptors.
24728074 2014 Enhanced prediction of Src homology 2 (SH2) domain binding potentials using a fluorescence polarization-derived c-Met, c-Kit, ErbB, and androgen receptor interactome.
24166736 2014 Lipoxin A? modulates adaptive immunity by decreasing memory B-cell responses via an ALX/FPR2-dependent mechanism.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20471366 2010 Phosphorylation at serine 318 is not required for inhibition of T cell activation by ALX.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20080636 2010 Resolvin D1 binds human phagocytes with evidence for proresolving receptors.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
16169852 2005 The carboxyl-terminal segment of the adaptor protein ALX directs its nuclear export during T cell activation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...