Property Summary

NCBI Gene PubMed Count 17
PubMed Score 1.90
PubTator Score 66.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 4.6e-36
osteosarcoma 7950 3.1e-11
acute myeloid leukemia 783 4.8e-03
interstitial cystitis 2312 8.0e-03

Expression

  Differential Expression (4)

Disease log2 FC p
acute myeloid leukemia 1.200 4.8e-03
interstitial cystitis 1.200 8.0e-03
osteosarcoma -4.029 3.1e-11
psoriasis 1.500 4.6e-36

Gene RIF (12)

AA Sequence

MTEAGKLPLPLPPRLDWFVHTQMGQLAQDGVPEWFHGAISREDAENLLESQPLGSFLIRVSHSHVGYTLS      1 - 70
YKAQSSCCHFMVKLLDDGTFMIPGEKVAHTSLDALVTFHQQKPIEPRRELLTQPCRQKDPANVDYEDLFL     71 - 140
YSNAVAEEAACPVSAPEEASPKPVLCHQSKERKPSAEMNRITTKEATSSCPPKSPLGETRQKLWRSLKML    141 - 210
PERGQRVRQQLKSHLATVNLSSLLDVRRSTVISGPGTGKGSQDHSGDPTSGDRGYTDPCVATSLKSPSQP    211 - 280
QAPKDRKVPTRKAERSVSCIEVTPGDRSWHQMVVRALSSQESKPEHQGLAEPENDQLPEEYQQPPPFAPG    281 - 350
YC                                                                        351 - 352
//

Text Mined References (18)

PMID Year Title