Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.29
PubTator Score 1.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8519 1.8e-09
osteosarcoma 7950 1.8e-05
adult high grade glioma 3801 2.8e-05
medulloblastoma, large-cell 6241 1.7e-04
glioblastoma 5792 7.7e-04
group 3 medulloblastoma 4104 1.0e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Smooth muscle tumor 13 3.891 1.9
Brachydactyly 156 3.204 1.6

Expression

  Differential Expression (6)

Disease log2 FC p
adult high grade glioma -1.200 2.8e-05
glioblastoma -1.200 7.7e-04
group 3 medulloblastoma 1.200 1.0e-03
medulloblastoma, large-cell -1.100 1.7e-04
osteosarcoma -1.612 1.8e-05
ovarian cancer -1.300 1.8e-09

Synonym

Accession Q96JK2 B2RN31 G3V4J7 O60559 Q8N3V3 Q8N3V5
Symbols BCRG2
BCRP2
WDR22
D14S1461E

Gene

PANTHER Protein Class (2)

PDB

3I89  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (12)

Gene RIF (2)

AA Sequence

MKRRAGLGGSMRSVVGFLSQRGLHGDPLLTQDFQRRRLRGCRNLYKKDLLGHFGCVNAIEFSNNGGQWLV      1 - 70
SGGDDRRVLLWHMEQAIHSRVKPIQLKGEHHSNIFCLAFNSGNTKVFSGGNDEQVILHDVESSETLDVFA     71 - 140
HEDAVYGLSVSPVNDNIFASSSDDGRVLIWDIRESPHGEPFCLANYPSAFHSVMFNPVEPRLLATANSKE    141 - 210
GVGLWDIRKPQSSLLRYGGNLSLQSAMSVRFNSNGTQLLALRRRLPPVLYDIHSRLPVFQFDNQGYFNSC    211 - 280
TMKSCCFAGDRDQYILSGSDDFNLYMWRIPADPEAGGIGRVVNGAFMVLKGHRSIVNQVRFNPHTYMICS    281 - 350
SGVEKIIKIWSPYKQPGCTGDLDGRIEDDSRCLYTHEEYISLVLNSGSGLSHDYANQSVQEDPRMMAFFD    351 - 420
SLVRREIEGWSSDSDSDLSESTILQLHAGVSERSGYTDSESSASLPRSPPPTVDESADNAFHLGPLRVTT    421 - 490
TNTVASTPPTPTCEDAASRQQRLSALRRYQDKRLLALSNESDSEENVCEVELDTDLFPRPRSPSPEDESS    491 - 560
SSSSSSSSEDEEELNERRASTWQRNAMRRRQKTTREDKPSAPIKPTNTYIGEDNYDYPQIKVDDLSSSPT    561 - 630
SSPERSTSTLEIQPSRASPTSDIESVERKIYKAYKWLRYSYISYSNNKDGETSLVTGEADEGRAGTSHKD    631 - 700
NPAPSSSKEACLNIAMAQRNQDLPPEGCSKDTFKEETPRTPSNGPGHEHSSHAWAEVPEGTSQDTGNSGS    701 - 770
VEHPFETKKLNGKALSSRAEEPPSPPVPKASGSTLNSGSGNCPRTQSDDSEERSLETICANHNNGRLHPR    771 - 840
PPHPHNNGQNLGELEVVAYSSPGHSDTDRDNSSLTGTLLHKDCCGSEMACETPNAGTREDPTDTPATDSS    841 - 910
RAVHGHSGLKRQRIELEDTDSENSSSEKKLKT                                          911 - 942
//

Text Mined References (17)

PMID Year Title