Property Summary

NCBI Gene PubMed Count 12
Grant Count 3
R01 Count 3
Funding $183,567.25
PubMed Score 7.40
PubTator Score 6.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Synonym

Accession Q96JF0 D3DVK3 Q53QP4 Q86Y44 Q8IUG7 Q96HE4 Alpha 2,6-ST 2
Symbols SIAT2
ST6GalII

Gene

Gene RIF (6)

PMID Text
20800603 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19850283 Observational study and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19768537 This suggests that ST6GAL2 transcription could be potentially activated for specific neuronal functions.
19240061 Observational study of gene-disease association. (HuGE Navigator)
12603328 identification and expression and localization in brain

AA Sequence

MKPHLKQWRQRMLFGIFAWGLLFLLIFIYFTDSNPAEPVPSSLSFLETRRLLPVQGKQRAIMGAAHEPSP      1 - 70
PGGLDARQALPRAHPAGSFHAGPGDLQKWAQSQDGFEHKEFFSSQVGRKSQSAFYPEDDDYFFAAGQPGW     71 - 140
HSHTQGTLGFPSPGEPGPREGAFPAAQVQRRRVKKRHRRQRRSHVLEEGDDGDRLYSSMSRAFLYRLWKG    141 - 210
NVSSKMLNPRLQKAMKDYLTANKHGVRFRGKREAGLSRAQLLCQLRSRARVRTLDGTEAPFSALGWRRLV    211 - 280
PAVPLSQLHPRGLRSCAVVMSAGAILNSSLGEEIDSHDAVLRFNSAPTRGYEKDVGNKTTIRIINSQILT    281 - 350
NPSHHFIDSSLYKDVILVAWDPAPYSANLNLWYKKPDYNLFTPYIQHRQRNPNQPFYILHPKFIWQLWDI    351 - 420
IQENTKEKIQPNPPSSGFIGILIMMSMCREVHVYEYIPSVRQTELCHYHELYYDAACTLGAYHPLLYEKL    421 - 490
LVQRLNMGTQGDLHRKGKVVLPGFQAVHCPAPSPVIPHS                                   491 - 529
//

Text Mined References (17)

PMID Year Title
23234360 2013 LC-MS/MS characterization of O-glycosylation sites and glycan structures of human cerebrospinal fluid glycoproteins.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19850283 2010 Identification of novel candidate genes for treatment response to risperidone and susceptibility for schizophrenia: integrated analysis among pharmacogenomics, mouse expression, and genetic case-control association approaches.
19768537 2010 Transcriptional regulation of the human ST6GAL2 gene in cerebral cortex and neuronal cells.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
17944600 2008 IL-6 and IL-8 increase the expression of glycosyltransferases and sulfotransferases involved in the biosynthesis of sialylated and/or sulfated Lewisx epitopes in the human bronchial mucosa.
16439063 2006 Probing the substrate specificity of four different sialyltransferases using synthetic beta-D-Galp-(1-->4)-beta-D-GlcpNAc-(1-->2)-alpha-D-Manp-(1-->O) (CH(2))7CH3 analogues general activating effect of replacing N-acetylglucosamine by N-propionylglucosamine.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
More...