Property Summary

NCBI Gene PubMed Count 12
PubMed Score 7.53
PubTator Score 6.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -1.300 1.5e-02
Astrocytoma, Pilocytic -1.600 1.5e-04
atypical teratoid / rhabdoid tumor -1.300 2.5e-03
chronic rhinosinusitis -1.111 3.6e-02
ependymoma -1.600 2.0e-05
glioblastoma -1.500 2.4e-05
interstitial cystitis 1.100 3.5e-02
invasive ductal carcinoma 1.080 4.4e-04
ovarian cancer -2.300 1.5e-04
psoriasis -2.000 3.1e-56
sonic hedgehog group medulloblastoma 2.200 5.5e-04
subependymal giant cell astrocytoma -1.610 1.4e-02
ulcerative colitis -1.600 1.8e-02

Gene RIF (6)

AA Sequence

MKPHLKQWRQRMLFGIFAWGLLFLLIFIYFTDSNPAEPVPSSLSFLETRRLLPVQGKQRAIMGAAHEPSP      1 - 70
PGGLDARQALPRAHPAGSFHAGPGDLQKWAQSQDGFEHKEFFSSQVGRKSQSAFYPEDDDYFFAAGQPGW     71 - 140
HSHTQGTLGFPSPGEPGPREGAFPAAQVQRRRVKKRHRRQRRSHVLEEGDDGDRLYSSMSRAFLYRLWKG    141 - 210
NVSSKMLNPRLQKAMKDYLTANKHGVRFRGKREAGLSRAQLLCQLRSRARVRTLDGTEAPFSALGWRRLV    211 - 280
PAVPLSQLHPRGLRSCAVVMSAGAILNSSLGEEIDSHDAVLRFNSAPTRGYEKDVGNKTTIRIINSQILT    281 - 350
NPSHHFIDSSLYKDVILVAWDPAPYSANLNLWYKKPDYNLFTPYIQHRQRNPNQPFYILHPKFIWQLWDI    351 - 420
IQENTKEKIQPNPPSSGFIGILIMMSMCREVHVYEYIPSVRQTELCHYHELYYDAACTLGAYHPLLYEKL    421 - 490
LVQRLNMGTQGDLHRKGKVVLPGFQAVHCPAPSPVIPHS                                   491 - 529
//

Text Mined References (17)

PMID Year Title