Property Summary

NCBI Gene PubMed Count 13
PubMed Score 5.77
PubTator Score 25.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
ovarian cancer 8492 1.45816986989096E-8
osteosarcoma 7933 2.10714259951885E-8
Disease Target Count Z-score Confidence
Type 2 diabetes mellitus 192 0.0 1.0
Disease Target Count Z-score Confidence
Cerebrotendinous xanthomatosis 12 4.124 2.1

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -2.406 0.000
ovarian cancer 1.100 0.000

Synonym

Accession Q96JD6 Q86Z16 Q86Z17 Q86Z18 Q9BU71 AF reductase
Symbols hTSP
htAKR
AKRDC1
AKR1CL2
LoopADR

Gene

PANTHER Protein Class (2)

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Opossum OMA Inparanoid
S.cerevisiae OMA Inparanoid

Gene RIF (2)

PMID Text
16385451 Observational study of gene-disease association. (HuGE Navigator)
15118078 results indicate that the expression of human testis aldo-keto reductase, down-regulated in the testicular tumour, is possibly controlled by mitogenic and hormonal signals

AA Sequence

MGDIPAVGLSSWKASPGKVTEAVKEAIDAGYRHFDCAYFYHNEREVGAGIRCKIKEGAVRREDLFIATKL      1 - 70
WCTCHKKSLVETACRKSLKALKLNYLDLYLIHWPMGFKPPHPEWIMSCSELSFCLSHPRVQDLPLDESNM     71 - 140
VIPSDTDFLDTWEAMEDLVITGLVKNIGVSNFNHEQLERLLNKPGLRFKPLTNQIECHPYLTQKNLISFC    141 - 210
QSRDVSVTAYRPLGGSCEGVDLIDNPVIKRIAKEHGKSPAQILIRFQIQRNVIVIPGSITPSHIKENIQV    211 - 280
FDFELTQHDMDNILSLNRNLRLAMFPITKNHKDYPFHIEY                                  281 - 320
//

Text Mined References (15)

PMID Year Title
25085501 2014 Integrated genome-wide association, coexpression network, and expression single nucleotide polymorphism analysis identifies novel pathway in allergic rhinitis.
24827717 2014 Genome wide association study: searching for genes underlying body mass index in the Chinese.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
20662065 2010 Identification of candidate loci at 6p21 and 21q22 in a genome-wide association study of cardiac manifestations of neonatal lupus.
19706366 2009 Aldo-keto reductase (AKR) superfamily: genomics and annotation.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...