Property Summary

NCBI Gene PubMed Count 13
Grant Count 17
R01 Count 11
Funding $1,304,739.77
PubMed Score 5.77
PubTator Score 25.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -2.406 0.000
ovarian cancer 1.100 0.000

Gene RIF (2)

PMID Text
16385451 Observational study of gene-disease association. (HuGE Navigator)
15118078 results indicate that the expression of human testis aldo-keto reductase, down-regulated in the testicular tumour, is possibly controlled by mitogenic and hormonal signals

AA Sequence

MGDIPAVGLSSWKASPGKVTEAVKEAIDAGYRHFDCAYFYHNEREVGAGIRCKIKEGAVRREDLFIATKL      1 - 70
WCTCHKKSLVETACRKSLKALKLNYLDLYLIHWPMGFKPPHPEWIMSCSELSFCLSHPRVQDLPLDESNM     71 - 140
VIPSDTDFLDTWEAMEDLVITGLVKNIGVSNFNHEQLERLLNKPGLRFKPLTNQIECHPYLTQKNLISFC    141 - 210
QSRDVSVTAYRPLGGSCEGVDLIDNPVIKRIAKEHGKSPAQILIRFQIQRNVIVIPGSITPSHIKENIQV    211 - 280
FDFELTQHDMDNILSLNRNLRLAMFPITKNHKDYPFHIEY                                  281 - 320
//

Text Mined References (15)

PMID Year Title
25085501 2014 Integrated genome-wide association, coexpression network, and expression single nucleotide polymorphism analysis identifies novel pathway in allergic rhinitis.
24827717 2014 Genome wide association study: searching for genes underlying body mass index in the Chinese.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
20662065 2010 Identification of candidate loci at 6p21 and 21q22 in a genome-wide association study of cardiac manifestations of neonatal lupus.
19706366 2009 Aldo-keto reductase (AKR) superfamily: genomics and annotation.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...