Property Summary

NCBI Gene PubMed Count 13
PubMed Score 8.02
PubTator Score 25.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8519 1.5e-08
osteosarcoma 7950 2.1e-08
Disease Target Count Z-score Confidence
Type 2 diabetes mellitus 272 0.0 1.1
Disease Target Count Z-score Confidence
Cerebrotendinous xanthomatosis 13 4.142 2.1
Hypotrichosis 1 15 3.078 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -2.406 2.1e-08
ovarian cancer 1.100 1.5e-08

Synonym

Accession Q96JD6 Q86Z16 Q86Z17 Q86Z18 Q9BU71 AF reductase
Symbols TAKR
hTSP
htAKR
AKRDC1
AKR1CL2
LoopADR

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MGDIPAVGLSSWKASPGKVTEAVKEAIDAGYRHFDCAYFYHNEREVGAGIRCKIKEGAVRREDLFIATKL      1 - 70
WCTCHKKSLVETACRKSLKALKLNYLDLYLIHWPMGFKPPHPEWIMSCSELSFCLSHPRVQDLPLDESNM     71 - 140
VIPSDTDFLDTWEAMEDLVITGLVKNIGVSNFNHEQLERLLNKPGLRFKPLTNQIECHPYLTQKNLISFC    141 - 210
QSRDVSVTAYRPLGGSCEGVDLIDNPVIKRIAKEHGKSPAQILIRFQIQRNVIVIPGSITPSHIKENIQV    211 - 280
FDFELTQHDMDNILSLNRNLRLAMFPITKNHKDYPFHIEY                                  281 - 320
//

Text Mined References (15)

PMID Year Title