Property Summary

NCBI Gene PubMed Count 13
PubMed Score 2.92
PubTator Score 2.59

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q96IZ7 A8K2R9 Q96QK2 Q9NZE5 SRrp53
Symbols BM-011
SFRS21
SRrp53

Gene

Gene RIF (6)

PMID Text
25937118 Data indicate that arginine/serine-rich coiled-coil 1 (RSRC1) represses estrogen receptor beta (ERbeta) transcriptional activity via ERbeta SUMOylation.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19065146 This study use Functional MRI and Genome Wide Association Analysis indentic novel gene(RSRC1) associated with schizophrenia.
19065146 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGRRSSDTEEESRSKRKKKHRRRSSSSSSSDSRTYSRKKGGRKSRSKSRSWSRDLQPRSHSYDRRRRHRS      1 - 70
SSSSSYGSRRKRSRSRSRGRGKSYRVQRSRSKSRTRRSRSRPRLRSHSRSSERSSHRRTRSRSRDRERRK     71 - 140
GRDKEKREKEKDKGKDKELHNIKRGESGNIKAGLEHLPPAEQAKARLQLVLEAAAKADEALKAKERNEEE    141 - 210
AKRRKEEDQATLVEQVKRVKEIEAIESDSFVQQTFRSSKEVKKSVEPSEVKQATSTSGPASAVADPPSTE    211 - 280
KEIDPTSIPTAIKYQDDNSLAHPNLFIEKADAEEKWFKRLIALRQERLMGSPVA                    281 - 334
//

Text Mined References (15)

PMID Year Title
25937118 2015 RSRC1 SUMOylation enhances SUMOylation and inhibits transcriptional activity of estrogen receptor ?.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20600988 2010 Identifying gene regulatory networks in schizophrenia.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19065146 2009 Gene discovery through imaging genetics: identification of two novel genes associated with schizophrenia.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
More...