Property Summary

NCBI Gene PubMed Count 13
PubMed Score 3.26
PubTator Score 2.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Gene RIF (6)

AA Sequence

MGRRSSDTEEESRSKRKKKHRRRSSSSSSSDSRTYSRKKGGRKSRSKSRSWSRDLQPRSHSYDRRRRHRS      1 - 70
SSSSSYGSRRKRSRSRSRGRGKSYRVQRSRSKSRTRRSRSRPRLRSHSRSSERSSHRRTRSRSRDRERRK     71 - 140
GRDKEKREKEKDKGKDKELHNIKRGESGNIKAGLEHLPPAEQAKARLQLVLEAAAKADEALKAKERNEEE    141 - 210
AKRRKEEDQATLVEQVKRVKEIEAIESDSFVQQTFRSSKEVKKSVEPSEVKQATSTSGPASAVADPPSTE    211 - 280
KEIDPTSIPTAIKYQDDNSLAHPNLFIEKADAEEKWFKRLIALRQERLMGSPVA                    281 - 334
//

Text Mined References (15)

PMID Year Title