Property Summary

NCBI Gene PubMed Count 14
PubMed Score 56.99
PubTator Score 26.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
group 3 medulloblastoma 2254 6.11749453372725E-6
osteosarcoma 7933 2.84116481532361E-5
lung cancer 4473 4.94498358895078E-4
ovarian cancer 8492 0.00426252554390443
Waldenstrons macroglobulinemia 765 0.00476496081904055
Multiple myeloma 1328 0.0347904898414761
Disease Target Count Z-score Confidence
Malaria 140 4.349 2.2

Expression

  Differential Expression (6)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.402 0.005
Multiple myeloma 1.234 0.035
osteosarcoma -1.204 0.000
lung cancer 1.300 0.000
group 3 medulloblastoma 1.600 0.000
ovarian cancer -1.300 0.004

Synonym

Accession Q96IY1 E7ETD5 Q5SY75 Q9H2M5 Q9NRN8 Q9Y415
Symbols DC8
MIS14
C1orf48

Gene

PDB

4NF9  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20231385 The hMis14, which contains a tripartite-binding domain for HP1 and two other kinetochore proteins, hMis13 and blinkin, is a cornerstone for the assembly of the inner centromere and kinetochore.

AA Sequence

MAGSPELVVLDPPWDKELAAGTESQALVSATPREDFRVRCTSKRAVTEMLQLCGRFVQKLGDALPEEIRE      1 - 70
PALRDAQWTFESAVQENISINGQAWQEASDNCFMDSDIKVLEDQFDEIIVDIATKRKQYPRKILECVIKT     71 - 140
IKAKQEILKQYHPVVHPLDLKYDPDPAPHMENLKCRGETVAKEISEAMKSLPALIEQGEGFSQVLRMQPV    141 - 210
IHLQRIHQEVFSSCHRKPDAKPENFITQIETTPTETASRKTSDMVLKRKQTKDCPQRKWYPLRPKKINLD    211 - 280
T//

Text Mined References (19)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20819937 2010 The MIS12 complex is a protein interaction hub for outer kinetochore assembly.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20231385 2010 Inner centromere formation requires hMis14, a trident kinetochore protein that specifically recruits HP1 to human chromosomes.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17981135 2007 Human Blinkin/AF15q14 is required for chromosome alignment and the mitotic checkpoint through direct interaction with Bub1 and BubR1.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
More...