Property Summary

NCBI Gene PubMed Count 15
PubMed Score 60.45
PubTator Score 26.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
group 3 medulloblastoma 4104 6.1e-06
osteosarcoma 7950 2.8e-05
lung cancer 4740 4.9e-04
ovarian cancer 8520 4.3e-03
Waldenstrons macroglobulinemia 765 4.8e-03
Multiple myeloma 1332 3.5e-02
Disease Target Count Z-score Confidence
Malaria 160 4.624 2.3

Expression

  Differential Expression (6)

Disease log2 FC p
group 3 medulloblastoma 1.600 6.1e-06
lung cancer 1.300 4.9e-04
Multiple myeloma 1.234 3.5e-02
osteosarcoma -1.204 2.8e-05
ovarian cancer -1.300 4.3e-03
Waldenstrons macroglobulinemia 1.402 4.8e-03

 GWAS Trait (1)

Protein-protein Interaction (11)

Gene RIF (2)

AA Sequence

MAGSPELVVLDPPWDKELAAGTESQALVSATPREDFRVRCTSKRAVTEMLQLCGRFVQKLGDALPEEIRE      1 - 70
PALRDAQWTFESAVQENISINGQAWQEASDNCFMDSDIKVLEDQFDEIIVDIATKRKQYPRKILECVIKT     71 - 140
IKAKQEILKQYHPVVHPLDLKYDPDPAPHMENLKCRGETVAKEISEAMKSLPALIEQGEGFSQVLRMQPV    141 - 210
IHLQRIHQEVFSSCHRKPDAKPENFITQIETTPTETASRKTSDMVLKRKQTKDCPQRKWYPLRPKKINLD    211 - 280
T//

Text Mined References (20)

PMID Year Title