Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.44
PubTator Score 0.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 1.9e-03
ovarian cancer 8520 3.4e-03
group 3 medulloblastoma 4104 4.3e-03
ependymoma 4679 4.4e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (4)

Disease log2 FC p
ependymoma -1.100 4.4e-02
group 3 medulloblastoma 1.100 4.3e-03
osteosarcoma -1.311 1.9e-03
ovarian cancer 1.300 3.4e-03

Gene RIF (2)

AA Sequence

MSMILSASVIRVRDGLPLSASTDYEQSTGMQECRKYFKMLSRKLAQLPDRCTLKTGHYNINFISSLGVSY      1 - 70
MMLCTENYPNVLAFSFLDELQKEFITTYNMMKTNTAVRPYCFIEFDNFIQRTKQRYNNPRSLSTKINLSD     71 - 140
MQTEIKLRPPYQISMCELGSANGVTSAFSVDCKGAGKISSAHQRLEPATLSGIVGFILSLLCGALNLIRG    141 - 210
FHAIESLLQSDGDDFNYIIAFFLGTAACLYQCYLLVYYTGWRNVKSFLTFGLICLCNMYLYELRNLWQLF    211 - 280
FHVTVGAFVTLQIWLRQAQGKAPDYDV                                               281 - 307
//

Text Mined References (15)

PMID Year Title