Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.44
PubTator Score 0.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 0.00194717916687324
ovarian cancer 8492 0.00338712603301226
group 3 medulloblastoma 2254 0.00352764039645513
ependymoma 2514 0.0443802636911949

Expression

  Differential Expression (4)

Disease log2 FC p
ependymoma -1.100 0.044
osteosarcoma -1.311 0.002
group 3 medulloblastoma 1.300 0.004
ovarian cancer 1.300 0.003

Synonym

Accession Q96IW7 B2RE26 Q9Y682
Symbols SEC22L2

Gene

  Ortholog (9)

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17499046 The 200 kDa crystal structure of Sec22 bound to Sec23/24 reveals that the transport signal is a folded epitope rather than a conventional short peptide sequence.

AA Sequence

MSMILSASVIRVRDGLPLSASTDYEQSTGMQECRKYFKMLSRKLAQLPDRCTLKTGHYNINFISSLGVSY      1 - 70
MMLCTENYPNVLAFSFLDELQKEFITTYNMMKTNTAVRPYCFIEFDNFIQRTKQRYNNPRSLSTKINLSD     71 - 140
MQTEIKLRPPYQISMCELGSANGVTSAFSVDCKGAGKISSAHQRLEPATLSGIVGFILSLLCGALNLIRG    141 - 210
FHAIESLLQSDGDDFNYIIAFFLGTAACLYQCYLLVYYTGWRNVKSFLTFGLICLCNMYLYELRNLWQLF    211 - 280
FHVTVGAFVTLQIWLRQAQGKAPDYDV                                               281 - 307
//

Text Mined References (15)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21516116 2011 Next-generation sequencing to generate interactome datasets.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17499046 2007 The transport signal on Sec22 for packaging into COPII-coated vesicles is a conformational epitope.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...