Knowledge Summary

Patent

No data available

Synonym

Accession Q96IR3
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MTRNVVRQEFEAPGKPQDSSQQDACLILVKGNWTTNEMEVK                                   1 - 41
//

Text Mined References (1)

PMID Year Title