Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.44
PubTator Score 140.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Breast cancer -1.100 2.0e-10
interstitial cystitis -2.800 3.6e-03
intraductal papillary-mucinous adenoma (... 3.200 9.2e-06
intraductal papillary-mucinous carcinoma... 2.000 4.2e-03
intraductal papillary-mucinous neoplasm ... 1.400 2.8e-02
lung carcinoma -1.100 1.3e-18
nasopharyngeal carcinoma -1.200 7.1e-09
non-small cell lung cancer -2.041 1.0e-23
osteosarcoma -2.063 1.4e-07
ovarian cancer -1.200 6.9e-04
pancreatic cancer 2.200 6.3e-06
spina bifida -1.829 4.8e-02
ulcerative colitis -1.400 3.2e-04

Gene RIF (1)

AA Sequence

MAELPGPFLCGALLGFLCLSGLAVEVKVPTEPLSTPLGKTAELTCTYSTSVGDSFALEWSFVQPGKPISE      1 - 70
SHPILYFTNGHLYPTGSKSKRVSLLQNPPTVGVATLKLTDVHPSDTGTYLCQVNNPPDFYTNGLGLINLT     71 - 140
VLVPPSNPLCSQSGQTSVGGSTALRCSSSEGAPKPVYNWVRLGTFPTPSPGSMVQDEVSGQLILTNLSLT    141 - 210
SSGTYRCVATNQMGSASCELTLSVTEPSQGRVAGALIGVLLGVLLLSVAAFCLVRFQKERGKKPKETYGG    211 - 280
SDLREDAIAPGISEHTCMRADSSKGFLERPSSASTVTTTKSKLPMVV                           281 - 327
//

Text Mined References (9)

PMID Year Title