Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.44
PubTator Score 140.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non-small cell lung cancer 2798 1.01503934506679E-23
lung carcinoma 2844 1.29290428270545E-18
Breast cancer 3099 2.00112231776523E-10
nasopharyngeal carcinoma 1056 7.05518557819797E-9
osteosarcoma 7933 1.36829544951327E-7
pancreatic cancer 2300 6.34398005225598E-6
interstitial cystitis 2299 1.01470112193268E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 1.14166222546766E-5
ulcerative colitis 2087 3.15295213953408E-4
ovarian cancer 8492 6.92886180965112E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00150564031202584
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00806474847886897
spina bifida 1064 0.0476565698273514

Expression

  Differential Expression (13)

Synonym

Accession Q96IQ7 O95791 Q9NX42
Symbols CTH
CTXL
2210413P10Rik

Gene

PANTHER Protein Class (1)

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG

Gene RIF (1)

PMID Text
20659327 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MAELPGPFLCGALLGFLCLSGLAVEVKVPTEPLSTPLGKTAELTCTYSTSVGDSFALEWSFVQPGKPISE      1 - 70
SHPILYFTNGHLYPTGSKSKRVSLLQNPPTVGVATLKLTDVHPSDTGTYLCQVNNPPDFYTNGLGLINLT     71 - 140
VLVPPSNPLCSQSGQTSVGGSTALRCSSSEGAPKPVYNWVRLGTFPTPSPGSMVQDEVSGQLILTNLSLT    141 - 210
SSGTYRCVATNQMGSASCELTLSVTEPSQGRVAGALIGVLLGVLLLSVAAFCLVRFQKERGKKPKETYGG    211 - 280
SDLREDAIAPGISEHTCMRADSSKGFLERPSSASTVTTTKSKLPMVV                           281 - 327
//

Text Mined References (9)

PMID Year Title
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
20659327 2010 Trait-stratified genome-wide association study identifies novel and diverse genetic associations with serologic and cytokine phenotypes in systemic lupus erythematosus.
17192395 2007 Comparative gene expression profiling of in vitro differentiated megakaryocytes and erythroblasts identifies novel activatory and inhibitory platelet membrane proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9862345 1998 CTX, a Xenopus thymocyte receptor, defines a molecular family conserved throughout vertebrates.