Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.03
PubTator Score 0.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 2.55522569762122E-12
nasopharyngeal carcinoma 1056 7.62701141614913E-7
Disease Target Count Z-score Confidence
Arrhythmogenic right ventricular cardiomyopathy 27 3.809 1.9

Expression

  Differential Expression (2)

Disease log2 FC p
posterior fossa group B ependymoma 4.200 0.000
nasopharyngeal carcinoma -1.600 0.000

Synonym

Accession Q96IM9 D3DWD6 Q5QP07 Q5QP11
Symbols

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum EggNOG Inparanoid

Gene RIF (1)

PMID Text
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

METNYLKRCFGNCLAQALAEVAKVRPSDPIEYLAHWLYHYRKTAKAKEENREKKIHLQEEYDSSLKEMEM      1 - 70
TEMLKQEEYQIQQNCEKCHKELTSETVSTKKTIFMQEDTNPLEKEALKQEFLPGTSSLIPGMPQQVPPSE     71 - 140
SAGQIDQNFKMPQEINYKEAFQHEVAHEMPPGSKSPF                                     141 - 177
//

Text Mined References (9)

PMID Year Title
19447967 2009 Shifted Transversal Design smart-pooling for high coverage interactome mapping.
18197198 2008 Myofibrillar myopathy with arrhythmogenic right ventricular cardiomyopathy 7: corroboration and narrowing of the critical region on 10q22.3.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.