Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.03
PubTator Score 0.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
nasopharyngeal carcinoma 1058 7.6e-07
ependymoma 4679 3.8e-06
Disease Target Count Z-score Confidence
Arrhythmogenic right ventricular cardiomyopathy 30 3.844 1.9

Expression

  Differential Expression (2)

Disease log2 FC p
ependymoma 2.500 3.8e-06
nasopharyngeal carcinoma -1.600 7.6e-07

Gene RIF (1)

AA Sequence

METNYLKRCFGNCLAQALAEVAKVRPSDPIEYLAHWLYHYRKTAKAKEENREKKIHLQEEYDSSLKEMEM      1 - 70
TEMLKQEEYQIQQNCEKCHKELTSETVSTKKTIFMQEDTNPLEKEALKQEFLPGTSSLIPGMPQQVPPSE     71 - 140
SAGQIDQNFKMPQEINYKEAFQHEVAHEMPPGSKSPF                                     141 - 177
//

Text Mined References (9)

PMID Year Title