Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.03
PubTator Score 0.56

Knowledge Summary


No data available


  Differential Expression (2)

Disease log2 FC p
posterior fossa group B ependymoma 4.200 0.000
nasopharyngeal carcinoma -1.600 0.000

Gene RIF (1)

16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

SAGQIDQNFKMPQEINYKEAFQHEVAHEMPPGSKSPF                                     141 - 177

Text Mined References (9)

PMID Year Title
19447967 2009 Shifted Transversal Design smart-pooling for high coverage interactome mapping.
18197198 2008 Myofibrillar myopathy with arrhythmogenic right ventricular cardiomyopathy 7: corroboration and narrowing of the critical region on 10q22.3.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.