Property Summary

NCBI Gene PubMed Count 17
PubMed Score 4.33
PubTator Score 4.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.900 4.4e-04
fibroadenoma -1.200 5.8e-03
malignant mesothelioma 2.300 1.5e-07

Gene RIF (7)

AA Sequence

MLPPPRPAAALALPVLLLLLVVLTPPPTGARPSPGPDYLRRGWMRLLAEGEGCAPCRPEECAAPRGCLAG      1 - 70
RVRDACGCCWECANLEGQLCDLDPSAHFYGHCGEQLECRLDTGGDLSRGEVPEPLCACRSQSPLCGSDGH     71 - 140
TYSQICRLQEAARARPDANLTVAHPGPCESGPQIVSHPYDTWNVTGQDVIFGCEVFAYPMASIEWRKDGL    141 - 210
DIQLPGDDPHISVQFRGGPQRFEVTGWLQIQAVRPSDEGTYRCLGRNALGQVEAPASLTVLTPDQLNSTG    211 - 280
IPQLRSLNLVPEEEAESEENDDYY                                                  281 - 304
//

Text Mined References (17)

PMID Year Title