Property Summary

NCBI Gene PubMed Count 17
PubMed Score 3.97
PubTator Score 4.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma 2.300 0.000
atypical teratoid / rhabdoid tumor 1.900 0.000
fibroadenoma -1.200 0.006

Gene RIF (7)

PMID Text
26315110 KAZALD1 hypomethylation indicates bad prognosis in small bowel adenocarcinoma
24002581 KAZALD1 promotes glioma malignant progression through invasion and proliferation
22836805 KAZALD1 gene was hypermethylated in sarcomatoid-type malignant peritoneal mesothelioma.
16385451 Observational study of gene-disease association. (HuGE Navigator)
15555553 This paper suggests that the mouse ortholog of this human gene plays a role in bone formation and regeneration.
15261838 This paper describes the identification and expression pattern of the mouse ortholog of the human gene.
15261838 Expression of Bono1 was detected in osteoblasts and secretory odontoblasts by in situ hybridization.

AA Sequence

MLPPPRPAAALALPVLLLLLVVLTPPPTGARPSPGPDYLRRGWMRLLAEGEGCAPCRPEECAAPRGCLAG      1 - 70
RVRDACGCCWECANLEGQLCDLDPSAHFYGHCGEQLECRLDTGGDLSRGEVPEPLCACRSQSPLCGSDGH     71 - 140
TYSQICRLQEAARARPDANLTVAHPGPCESGPQIVSHPYDTWNVTGQDVIFGCEVFAYPMASIEWRKDGL    141 - 210
DIQLPGDDPHISVQFRGGPQRFEVTGWLQIQAVRPSDEGTYRCLGRNALGQVEAPASLTVLTPDQLNSTG    211 - 280
IPQLRSLNLVPEEEAESEENDDYY                                                  281 - 304
//

Text Mined References (17)

PMID Year Title
26315110 2015 Comprehensive molecular pathology analysis of small bowel adenocarcinoma reveals novel targets with potential for clinical utility.
25257335 2014 Novel interstitial deletion of 10q24.3-25.1 associated with multiple congenital anomalies including lobar holoprosencephaly, cleft lip and palate, and hypoplastic kidneys.
24002581 2013 Epigenetic silencing of KAZALD1 confers a better prognosis and is associated with malignant transformation/progression in glioma.
22836805 2012 Characterization of DNA hypermethylation in two cases of peritoneal mesothelioma.
19887624 2009 Epigenetic profiles distinguish malignant pleural mesothelioma from lung adenocarcinoma.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15555553 2004 Role of a new member of IGFBP superfamily, IGFBP-rP10, in proliferation and differentiation of osteoblastic cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
More...