Property Summary

NCBI Gene PubMed Count 13
PubMed Score 9.64
PubTator Score 8.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.6

Expression

  Differential Expression (10)

Disease log2 FC p
Breast cancer 1.300 3.7e-11
breast carcinoma 1.100 8.0e-20
intraductal papillary-mucinous neoplasm ... -1.300 5.2e-03
invasive ductal carcinoma 1.700 2.0e-02
lung adenocarcinoma 1.349 1.8e-08
lung carcinoma 1.100 9.8e-21
osteosarcoma -1.402 3.3e-03
ovarian cancer 1.100 3.2e-05
pancreatic ductal adenocarcinoma liver m... -1.264 7.8e-03
subependymal giant cell astrocytoma 1.265 4.6e-02

Gene RIF (7)

AA Sequence

MASATAAAARRGLGRALPLFWRGYQTERGVYGYRPRKPESREPQGALERPPVDHGLARLVTVYCEHGHKA      1 - 70
AKINPLFTGQALLENVPEIQALVQTLQGPFHTAGLLNMGKEEASLEEVLVYLNQIYCGQISIETSQLQSQ     71 - 140
DEKDWFAKRFEELQKETFTTEERKHLSKLMLESQEFDHFLATKFSTVKRYGGEGAESMMGFFHELLKMSA    141 - 210
YSGITDVIIGMPHRGRLNLLTGLLQFPPELMFRKMRGLSEFPENFSATGDVLSHLTSSVDLYFGAHHPLH    211 - 280
VTMLPNPSHLEAVNPVAVGKTRGRQQSRQDGDYSPDNSAQPGDRVICLQVHGDASFCGQGIVPETFTLSN    281 - 350
LPHFRIGGSVHLIVNNQLGYTTPAERGRSSLYCSDIGKLVGCAIIHVNGDSPEEVVRATRLAFEYQRQFR    351 - 420
KDVIIDLLCYRQWGHNELDEPFYTNPIMYKIIRARKSIPDTYAEHLIAGGLMTQEEVSEIKSSYYAKLND    421 - 490
HLNNMAHYRPPALNLQAHWQGLAQPEAQITTWSTGVPLDLLRFVGMKSVEVPRELQMHSHLLKTHVQSRM    491 - 560
EKMMDGIKLDWATAEALALGSLLAQGFNVRLSGQDVGRGTFSQRHAIVVCQETDDTYIPLNHMDPNQKGF    561 - 630
LEVSNSPLSEEAVLGFEYGMSIESPKLLPLWEAQFGDFFNGAQIIFDTFISGGEAKWLLQSGIVILLPHG    631 - 700
YDGAGPDHSSCRIERFLQMCDSAEEGVDGDTVNMFVVHPTTPAQYFHLLRRQMVRNFRKPLIVASPKMLL    701 - 770
RLPAAVSTLQEMAPGTTFNPVIGDSSVDPKKVKTLVFCSGKHFYSLVKQRESLGAKKHDFAIIRVEELCP    771 - 840
FPLDSLQQEMSKYKHVKDHIWSQEEPQNMGPWSFVSPRFEKQLACKLRLVGRPPLPVPAVGIGTVHLHQH    841 - 910
EDILAKTFA                                                                 911 - 919
//

Text Mined References (17)

PMID Year Title