Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
non-small cell lung cancer 2890 4.7e-14

Expression

  Differential Expression (1)

Disease log2 FC p
non-small cell lung cancer 1.026 4.7e-14

Synonym

Accession Q96HV5 A8K4B3 D3DNU2 Q6ZMJ0
Symbols 2900010K02Rik

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MRPLLGLLLVFAGCTFALYLLSTRLPRGRRLGSTEEAGGRSLWFPSDLAELRELSEVLREYRKEHQAYVF      1 - 70
LLFCGAYLYKQGFAIPGSSFLNVLAGALFGPWLGLLLCCVLTSVGATCCYLLSSIFGKQLVVSYFPDKVA     71 - 140
LLQRKVEENRNSLFFFLLFLRLFPMTPNWFLNLSAPILNIPIVQFFFSVLIGLIPYNFICVQTGSILSTL    141 - 210
TSLDALFSWDTVFKLLAIAMVALIPGTLIKKFSQKHLQLNETSTANHIHSRKDT                    211 - 264
//

Text Mined References (6)

PMID Year Title