Property Summary

NCBI Gene PubMed Count 14
Grant Count 8
R01 Count 3
Funding $883,226.8
PubMed Score 66.61
PubTator Score 6.43

Knowledge Summary

Patent

No data available

Expression

Gene RIF (4)

PMID Text
23918301 rs56228771 may contribute to hepatocarcinogenesis, possibly by affecting SGSM3 expression through a miRNA-mediated regulation.
23586710 The CIP85 was observed to interact with clathrin, which suggested a role for CIP85 in the clathrin-mediated internalization of Cx43.
17509819 Identification of novel protein SGSM3 which modulates small G protein (RAP and RAB)-mediated signaling pathway.
15541357 MAP decreased the AP-1-dependent promoter activity additively with merlin in NIH3T3 cells.Results suggest that MAP may play a cooperative role in the merlin-mediated growth suppression of cells.

AA Sequence

MSGSHTPACGPFSALTPSIWPQEILAKYTQKEESAEQPEFYYDEFGFRVYKEEGDEPGSSLLANSPLMED      1 - 70
APQRLRWQAHLEFTHNHDVGDLTWDKIAVSLPRSEKLRSLVLAGIPHGMRPQLWMRLSGALQKKRNSELS     71 - 140
YREIVKNSSNDETIAAKQIEKDLLRTMPSNACFASMGSIGVPRLRRVLRALAWLYPEIGYCQGTGMVAAC    141 - 210
LLLFLEEEDAFWMMSAIIEDLLPASYFSTTLLGVQTDQRVLRHLIVQYLPRLDKLLQEHDIELSLITLHW    211 - 280
FLTAFASVVDIKLLLRIWDLFFYEGSRVLFQLTLGMLHLKEEELIQSENSASIFNTLSDIPSQMEDAELL    281 - 350
LGVAMRLAGSLTDVAVETQRRKHLAYLIADQGQLLGAGTLTNLSQVVRRRTQRRKSTITALLFGEDDLEA    351 - 420
LKAKNIKQTELVADLREAILRVARHFQCTDPKNCSVELTPDYSMESHQRDHENYVACSRSHRRRAKALLD    421 - 490
FERHDDDELGFRKNDIITIVSQKDEHCWVGELNGLRGWFPAKFVEVLDERSKEYSIAGDDSVTEGVTDLV    491 - 560
RGTLCPALKALFEHGLKKPSLLGGACHPWLFIEEAAGREVERDFASVYSRLVLCKTFRLDEDGKVLTPEE    561 - 630
LLYRAVQSVNVTHDAVHAQMDVKLRSLICVGLNEQVLHLWLEVLCSSLPTVEKWYQPWSFLRSPGWVQIK    631 - 700
CELRVLCCFAFSLSQDWELPAKREAQQPLKEGVRDMLVKHHLFSWDVDG                         701 - 749
//

Text Mined References (19)

PMID Year Title
25342443 2014 Genome-wide association study identifies multiple loci associated with both mammographic density and breast cancer risk.
23918301 2014 Association between an insertion/deletion polymorphism within 3'UTR of SGSM3 and risk of hepatocellular carcinoma.
23586710 2013 The connexin43-interacting protein, CIP85, mediates the internalization of connexin43 from the plasma membrane.
19570815 2009 A genome-wide association study of northwestern Europeans involves the C-type natriuretic peptide signaling pathway in the etiology of human height variation.
19077034 2009 Identification and characterization of a novel Tre-2/Bub2/Cdc16 (TBC) protein that possesses Rab3A-GAP activity.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17646400 2007 Functional dissection of Rab GTPases involved in primary cilium formation.
17562788 2007 Specific Rab GTPase-activating proteins define the Shiga toxin and epidermal growth factor uptake pathways.
17509819 2007 Identification of three novel proteins (SGSM1, 2, 3) which modulate small G protein (RAP and RAB)-mediated signaling pathway.
More...