Property Summary

NCBI Gene PubMed Count 19
PubMed Score 6.66
PubTator Score 2.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
active ulcerative colitis 1.085 4.9e-02
adult high grade glioma -1.300 9.0e-05
ductal carcinoma in situ 1.300 1.9e-02
fibroadenoma 1.200 1.1e-02
glioblastoma -1.100 2.3e-05
group 3 medulloblastoma -1.200 1.9e-03
interstitial cystitis -2.700 3.9e-04
lung adenocarcinoma 2.000 7.2e-11
medulloblastoma, large-cell -1.500 1.7e-03
pancreatic ductal adenocarcinoma liver m... -2.527 6.6e-03
pituitary cancer 1.700 6.3e-05
primitive neuroectodermal tumor -1.400 5.4e-03
urothelial carcinoma -1.500 3.3e-02

Gene RIF (5)

AA Sequence

MDGLRQRVEHFLEQRNLVTEVLGALEAKTGVEKRYLAAGAVTLLSLYLLFGYGASLLCNLIGFVYPAYAS      1 - 70
IKAIESPSKDDDTVWLTYWVVYALFGLAEFFSDLLLSWFPFYYVGKCAFLLFCMAPRPWNGALMLYQRVV     71 - 140
RPLFLRHHGAVDRIMNDLSGRALDAAAGITRNVLQVLARSRAGITPVAVAGPSTPLEADLKPSQTPQPKD    141 - 210
K//

Text Mined References (24)

PMID Year Title