Property Summary

NCBI Gene PubMed Count 15
PubMed Score 4.11
PubTator Score 2.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung adenocarcinoma 2714 7.22145137814896E-11
interstitial cystitis 2299 1.53460882149652E-6
glioblastoma 5572 2.34693303716154E-5
pituitary cancer 1972 6.25023588419893E-5
adult high grade glioma 2148 9.01888200650757E-5
medulloblastoma, large-cell 6234 0.00168195082059504
medulloblastoma 1524 0.00202823084828545
primitive neuroectodermal tumor 3031 0.00544781515378058
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00661685677346788
fibroadenoma 557 0.0107706227335563
ductal carcinoma in situ 1745 0.0186613937326975
urothelial carcinoma 318 0.0326518211604521
active ulcerative colitis 477 0.0494353844778318
Disease Target Count Z-score Confidence
Peutz-Jeghers syndrome 23 3.012 1.5

Expression

  Differential Expression (13)

Disease log2 FC p
urothelial carcinoma -1.500 0.033
glioblastoma -1.100 0.000
medulloblastoma -1.300 0.002
medulloblastoma, large-cell -1.500 0.002
primitive neuroectodermal tumor -1.400 0.005
pancreatic ductal adenocarcinoma liver m... -2.527 0.007
active ulcerative colitis 1.085 0.049
fibroadenoma 1.200 0.011
interstitial cystitis -3.000 0.000
adult high grade glioma -1.300 0.000
lung adenocarcinoma 2.000 0.000
ductal carcinoma in situ 1.300 0.019
pituitary cancer 1.700 0.000

Synonym

Accession Q96HR9 B2RE01 D6W5Z0 Q96LM0
Symbols DP1L1
TB2L1
Yip2f
C19orf32

Gene

PANTHER Protein Class (1)

  Ortholog (11)

Species Source
Mouse EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG
C. elegans OMA Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (4)

PMID Text
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19924442 DP1L1 polymorphisms are associated with colon cancer and IBD. This indicates that DP1L1 plays a functional role in these conditions. Thus DP1L1 may be a diagnostic and therapeutic target for colon cancer and IBD.
19924442 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MDGLRQRVEHFLEQRNLVTEVLGALEAKTGVEKRYLAAGAVTLLSLYLLFGYGASLLCNLIGFVYPAYAS      1 - 70
IKAIESPSKDDDTVWLTYWVVYALFGLAEFFSDLLLSWFPFYYVGKCAFLLFCMAPRPWNGALMLYQRVV     71 - 140
RPLFLRHHGAVDRIMNDLSGRALDAAAGITRNVKPSQTPQPKDK                              141 - 184
//

Text Mined References (19)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24098485 2013 REEPs are membrane shaping adapter proteins that modulate specific g protein-coupled receptor trafficking by affecting ER cargo capacity.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19924442 2010 Polymorphisms of the apoptosis-associated gene DP1L1 (deleted in polyposis 1-like 1) in colon cancer and inflammatory bowel disease.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
More...