Property Summary

NCBI Gene PubMed Count 18
Grant Count 12
R01 Count 12
Funding $597,822
PubMed Score 0.00
PubTator Score 17.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (2)

Disease log2 FC p
acute quadriplegic myopathy 1.630 0.000
ovarian cancer 1.500 0.000

Gene RIF (2)

PMID Text
26581417 Telomere length is associated with Esophageal squamous cell carcinoma risk in a U-shaped pattern and demonstrates that TL-SNPs may not be important in carcinogenesis in Chinese population.
20797317 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MEVVEAAAAQLETLKFNGTDFGVGEGPAAPSPGSAPVPGTQPPLQSFEGSPDAGQTVEVKPAGEQPLQPV      1 - 70
LNAVAAGTPAPQPQPPAESPACGDCVTSPGAAEPARAPDSLETSDSDSDSDSETDSDSSSSSSSSSSSSS     71 - 140
SSSSSCISLPPVLSDGDDDLQIEKENKNFPLKTKDELLLNELPSVEELTIILPEDIELKPLGMVSSIIEQ    141 - 210
LVIIESMTNLPPVNEETVIFKSDRQAAGKIFEIFGPVAHPFYVLRFNSSDHIESKGIKIKETMYFAPSMK    211 - 280
DFTQYIFTEKLKQDKGSDASWKNDQEPPPEALDFSDDEKEKEAKQRKKSQIQGRKKLKSEFNEPGEDFTE    281 - 350
VHQNWNAHSSASEHAKGYRNREFTRGFSRARYPRSCHGRPPPQHFYNSEHMVSQETSGFPSQRQNNPIMP    351 - 420
QYPFPLPVFDMHNFPLRPPPPPPPPPVNMGWATPNMAAHPLLNLPYSLPPPPPPPPLPPPPSSGDSNSHF    421 - 490
GPYY                                                                      491 - 494
//

Text Mined References (27)

PMID Year Title
26581417 2015 U-shaped association between telomere length and esophageal squamous cell carcinoma risk: a case-control study in Chinese population.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25467444 2014 Proteostatic control of telomerase function through TRiC-mediated folding of TCAB1.
25416956 2014 A proteome-scale map of the human interactome network.
25023989 2014 A novel colorectal cancer risk locus at 4q32.2 identified from an international genome-wide association study.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22527283 2012 An enhanced H/ACA RNP assembly mechanism for human telomerase RNA.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
More...