Property Summary

NCBI Gene PubMed Count 21
PubMed Score 0.00
PubTator Score 17.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
acute quadriplegic myopathy 1158 8.4e-07
ovarian cancer 8520 3.4e-06

Expression

  Differential Expression (2)

Disease log2 FC p
acute quadriplegic myopathy 1.630 8.4e-07
ovarian cancer 1.500 3.4e-06

Gene RIF (5)

AA Sequence

MEVVEAAAAQLETLKFNGTDFGVGEGPAAPSPGSAPVPGTQPPLQSFEGSPDAGQTVEVKPAGEQPLQPV      1 - 70
LNAVAAGTPAPQPQPPAESPACGDCVTSPGAAEPARAPDSLETSDSDSDSDSETDSDSSSSSSSSSSSSS     71 - 140
SSSSSCISLPPVLSDGDDDLQIEKENKNFPLKTKDELLLNELPSVEELTIILPEDIELKPLGMVSSIIEQ    141 - 210
LVIIESMTNLPPVNEETVIFKSDRQAAGKIFEIFGPVAHPFYVLRFNSSDHIESKGIKIKETMYFAPSMK    211 - 280
DFTQYIFTEKLKQDKGSDASWKNDQEPPPEALDFSDDEKEKEAKQRKKSQIQGRKKLKSEFNEPGEDFTE    281 - 350
VHQNWNAHSSASEHAKGYRNREFTRGFSRARYPRSCHGRPPPQHFYNSEHMVSQETSGFPSQRQNNPIMP    351 - 420
QYPFPLPVFDMHNFPLRPPPPPPPPPVNMGWATPNMAAHPLLNLPYSLPPPPPPPPLPPPPSSGDSNSHF    421 - 490
GPYY                                                                      491 - 494
//

Text Mined References (31)

PMID Year Title