Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
pituitary cancer 1972 1.0e-05
osteosarcoma 7950 3.9e-05
adult high grade glioma 3801 4.7e-04
glioblastoma 5792 1.5e-03
primary Sjogren syndrome 735 1.5e-03
gastric carcinoma 807 3.9e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Alzheimer's disease 658 0.0 2.2

Expression

  Differential Expression (6)

Disease log2 FC p
adult high grade glioma 1.200 4.7e-04
gastric carcinoma 1.500 3.9e-02
glioblastoma 1.100 1.5e-03
osteosarcoma -2.430 3.9e-05
pituitary cancer 1.800 1.0e-05
primary Sjogren syndrome 1.300 1.5e-03

Gene RIF (1)

AA Sequence

MILLRASEVRQLLHNKFVVILGDSVHRAVYKDLVLLLQKDRLLTPGQLRARGELNFEQDELVDGGQRGHM      1 - 70
HNGLNYREVREFRSDHHLVRFYFLTRVYSDYLQTILKELQSGEHAPDLVIMNSCLWDISRYGPNSWRSYL     71 - 140
ENLENLFQCLGQVLPESCLLVWNTAMPVGEEVTGGFLPPKLRRQKATFLKNEVVKANFHSATEARKHNFD    141 - 210
VLDLHFHFRHARENLHWDGVHWNGRVHRCLSQLLLAHVADAWGVELPHRHPVGEWIKKKKPGPRVEGPPQ    211 - 280
ANRNHPALPLSPPLPSPTYRPLLGFPPQRLPLLPLLSPQPPPPILHHQGMPRFPQGPPDACFSSDHTFQS    281 - 350
DQFYCHSDVPSSAHAGFFVEDNFMVGPQLPMPFFPTPRYQRPAPVVHRGFGRYRPRGPYTPWGQRPRPSK    351 - 420
RRAPANPEPRPQ                                                              421 - 432
//

Text Mined References (6)

PMID Year Title