Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -2.430 0.000
glioblastoma 1.100 0.002
adult high grade glioma 1.200 0.000
primary Sjogren syndrome 1.300 0.002
gastric carcinoma 1.500 0.039
pituitary cancer 1.800 0.000

Synonym

Accession Q96HM7 Q96B20
Symbols FAM113B

Gene

 Compartment GO Term (1)

Gene RIF (1)

PMID Text
21044367 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MILLRASEVRQLLHNKFVVILGDSVHRAVYKDLVLLLQKDRLLTPGQLRARGELNFEQDELVDGGQRGHM      1 - 70
HNGLNYREVREFRSDHHLVRFYFLTRVYSDYLQTILKELQSGEHAPDLVIMNSCLWDISRYGPNSWRSYL     71 - 140
ENLENLFQCLGQVLPESCLLVWNTAMPVGEEVTGGFLPPKLRRQKATFLKNEVVKANFHSATEARKHNFD    141 - 210
VLDLHFHFRHARENLHWDGVHWNGRVHRCLSQLLLAHVADAWGVELPHRHPVGEWIKKKKPGPRVEGPPQ    211 - 280
ANRNHPALPLSPPLPSPTYRPLLGFPPQRLPLLPLLSPQPPPPILHHQGMPRFPQGPPDACFSSDHTFQS    281 - 350
DQFYCHSDVPSSAHAGFFVEDNFMVGPQLPMPFFPTPRYQRPAPVVHRGFGRYRPRGPYTPWGQRPRPSK    351 - 420
RRAPANPEPRPQ                                                              421 - 432
//

Text Mined References (6)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21044367 2010 An integrative method for scoring candidate genes from association studies: application to warfarin dosing.
20056006 2010 Novel eukaryotic enzymes modifying cell-surface biopolymers.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.