Property Summary

NCBI Gene PubMed Count 10
PubMed Score 17.63
PubTator Score 11.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.200 2.2e-02
oligodendroglioma 1.100 8.1e-14
osteosarcoma -1.239 1.4e-03
ovarian cancer 1.300 1.5e-03
pancreatic ductal adenocarcinoma liver m... -1.464 3.8e-03

Gene RIF (1)

AA Sequence

MAALGSPSHTFRGLLRELRYLSAATGRPYRDTAAYRYLVKAFRAHRVTSEKLCRAQHELHFQAATYLCLL      1 - 70
RSIRKHVALHQEFHGKGERSVEESAGLVGLKLPHQPGGKGWEP                                71 - 113
//

Text Mined References (13)

PMID Year Title