Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.07

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
adrenocortical carcinoma 1.173 1.5e-04
atypical teratoid / rhabdoid tumor -1.200 3.0e-05
Breast cancer 3.300 2.5e-02
glioblastoma -1.100 8.6e-04
intraductal papillary-mucinous adenoma (... 1.200 9.5e-03
medulloblastoma, large-cell -1.200 1.1e-02
ovarian cancer 2.100 2.2e-05

AA Sequence

MTDLNDNICKRYIKMITNIVILSLIICISLAFWIISMTASTYYGNLRPISPWRWLFSVVVPVLIVSNGLK      1 - 70
KKSLDHSGALGGLVVGFILTIANFSFFTSLLMFFLSSSKLTKWKGEVKKRLDSEYKEGGQRNWVQVFCNG     71 - 140
AVPTELALLYMIENGPGEIPVDFSKQYSASWMCLSLLAALACSAGDTWASEVGPVLSKSSPRLITTWEKV    141 - 210
PVGTNGGVTVVGLVSSLLGGTFVGIAYFLTQLIFVNDLDISAPQWPIIAFGGLAGLLGSIVDSYLGATMQ    211 - 280
YTGLDESTGMVVNSPTNKARHIAGKPILDNNAVNLFSSVLIALLLPTAAWGFWPRG                  281 - 336
//

Text Mined References (6)

PMID Year Title