Property Summary

NCBI Gene PubMed Count 46
Grant Count 91
R01 Count 51
Funding $13,508,448.77
PubMed Score 358.28
PubTator Score 297.77

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q96HC4 A8K6F9 D6RB78 E9PBF5 O60705 Q56VN4 Q5UW38 Q8WVK0
Symbols L9
ENH
LIM
ENH1

Gene

PDB

2DAR   2UZC  

Gene RIF (29)

PMID Text
24064681 It can be deduced that the nonsynonymous rs7690296 polymorphism of PDLIM5 could play an important role in the pathophysiology of both bipolar disorder and schizophrenia.
23031404 The significant difference in expression of PDLIM5 mRNA in the peripheral blood leukocytes of treatment-naive bipolar (BPD) patients versus that of healthy control subjects suggests that it may be a good biological marker for BPD.
22741436 PDLIM5 (rs17021918,T), SLC22A3 (rs9364554,C) and NKX3-1 (rs1512268,A) SNPs might not be associated with prostate cancer in Chinese men.
21266195 LIM domains have a novel molecular function: the regulation of PKC activities in a PKC isoform-specific manner.
20878950 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20564319 Meta-analysis of gene-disease association. (HuGE Navigator)
19767753 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19448850 Our results suggest that PDLIM5 might play a role in susceptibility to bipolar disorder among the Chinese Han population.
19328558 Observational study of gene-disease association. (HuGE Navigator)
18496210 The aim of this study was to investigate the association between PDLIM5 single nucleotide polymorphisms and bipolar disorder in a case-control sample.
More...

AA Sequence

MSNYSVSLVGPAPWGFRLQGGKDFNMPLTISSLKDGGKAAQANVRIGDVVLSIDGINAQGMTHLEAQNKI      1 - 70
KGCTGSLNMTLQRASAAPKPEPVPVQKGEPKEVVKPVPITSPAVSKVTSTNNMAYNKAPRPFGSVSSPKV     71 - 140
TSIPSPSSAFTPAHATTSSHASPSPVAAVTPPLFAASGLHANANLSADQSPSALSAGKTAVNVPRQPTVT    141 - 210
SVCSETSQELAEGQRRGSQGDSKQQNGPPRKHIVERYTEFYHVPTHSDASKKRLIEDTEDWRPRTGTTQS    211 - 280
RSFRILAQITGTEHLKESEADNTKKANNSQEPSPQLASSVASTRSMPESLDSPTSGRPGVTSLTAAAAFK    281 - 350
PVGSTGVIKSPSWQRPNQGVPSTGRISNSATYSGSVAPANSALGQTQPSDQDTLVQRAEHIPAGKRTPMC    351 - 420
AHCNQVIRGPFLVALGKSWHPEEFNCAHCKNTMAYIGFVEEKGALYCELCYEKFFAPECGRCQRKILGEV    421 - 490
ISALKQTWHVSCFVCVACGKPIRNNVFHLEDGEPYCETDYYALFGTICHGCEFPIEAGDMFLEALGYTWH    491 - 560
DTCFVCSVCCESLEGQTFFSKKDKPLCKKHAHSVNF                                      561 - 596
//

Text Mined References (60)

PMID Year Title
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24064681 2013 Nonsynonymous polymorphisms of the PDLIM5 gene association with the occurrence of both bipolar disorder and schizophrenia.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23031404 2012 Peripheral PDLIM5 expression in bipolar disorder and the effect of olanzapine administration.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22741436 2012 [Association of prostate cancer with PDLIM5, SLC22A3 and NKX3-1 in Chinese men].
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
More...