Property Summary

NCBI Gene PubMed Count 49
PubMed Score 370.39
PubTator Score 297.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Myocardial Ischemia 169 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Prostate cancer 175 0.0 3.0
Disease Target Count Z-score Confidence
Hepatitis B 108 3.952 2.0
Nephrogenic adenofibroma 4 3.073 1.5
Hepatitis 67 3.001 1.5

Expression

  Differential Expression (34)

Disease log2 FC p
acute quadriplegic myopathy 1.146 3.6e-05
adult high grade glioma 1.200 1.6e-02
aldosterone-producing adenoma -1.067 1.8e-02
Amyotrophic lateral sclerosis 1.097 2.3e-06
astrocytic glioma 2.500 1.7e-02
Astrocytoma, Pilocytic 1.900 3.6e-06
atypical teratoid / rhabdoid tumor 2.500 9.6e-05
Becker muscular dystrophy -1.038 2.8e-02
Breast cancer 3.000 2.5e-02
dermatomyositis 1.200 1.5e-02
Down syndrome 1.100 5.6e-03
ependymoma 1.900 4.0e-02
glioblastoma 1.300 1.0e-03
group 4 medulloblastoma -1.100 1.1e-02
hereditary spastic paraplegia -1.031 4.1e-02
intraductal papillary-mucinous adenoma (... 2.100 9.3e-04
intraductal papillary-mucinous carcinoma... 2.100 7.6e-04
intraductal papillary-mucinous neoplasm ... 2.200 5.9e-03
malignant mesothelioma -1.100 7.9e-05
medulloblastoma, large-cell 2.000 2.2e-05
non-small cell lung cancer 1.306 4.3e-09
oligodendroglioma 2.600 1.0e-03
osteosarcoma 3.146 2.1e-06
ovarian cancer -1.100 1.3e-07
pancreatic cancer 1.100 2.7e-02
Pick disease 1.400 2.3e-04
pituitary cancer -1.600 1.5e-04
primary pancreatic ductal adenocarcinoma 1.136 1.1e-02
primitive neuroectodermal tumor 1.400 5.3e-04
psoriasis -4.400 5.0e-05
Rheumatoid arthritis 1.200 2.0e-02
spina bifida -1.209 3.5e-02
subependymal giant cell astrocytoma 1.732 2.1e-02
tuberculosis -1.700 2.4e-06

Protein-protein Interaction (1)

Gene RIF (32)

AA Sequence

MSNYSVSLVGPAPWGFRLQGGKDFNMPLTISSLKDGGKAAQANVRIGDVVLSIDGINAQGMTHLEAQNKI      1 - 70
KGCTGSLNMTLQRASAAPKPEPVPVQKGEPKEVVKPVPITSPAVSKVTSTNNMAYNKAPRPFGSVSSPKV     71 - 140
TSIPSPSSAFTPAHATTSSHASPSPVAAVTPPLFAASGLHANANLSADQSPSALSAGKTAVNVPRQPTVT    141 - 210
SVCSETSQELAEGQRRGSQGDSKQQNGPPRKHIVERYTEFYHVPTHSDASKKRLIEDTEDWRPRTGTTQS    211 - 280
RSFRILAQITGTEHLKESEADNTKKANNSQEPSPQLASSVASTRSMPESLDSPTSGRPGVTSLTAAAAFK    281 - 350
PVGSTGVIKSPSWQRPNQGVPSTGRISNSATYSGSVAPANSALGQTQPSDQDTLVQRAEHIPAGKRTPMC    351 - 420
AHCNQVIRGPFLVALGKSWHPEEFNCAHCKNTMAYIGFVEEKGALYCELCYEKFFAPECGRCQRKILGEV    421 - 490
ISALKQTWHVSCFVCVACGKPIRNNVFHLEDGEPYCETDYYALFGTICHGCEFPIEAGDMFLEALGYTWH    491 - 560
DTCFVCSVCCESLEGQTFFSKKDKPLCKKHAHSVNF                                      561 - 596
//

Text Mined References (64)

PMID Year Title