Property Summary

NCBI Gene PubMed Count 35
Grant Count 66
R01 Count 14
Funding $6,566,294.29
PubMed Score 86.07
PubTator Score 45.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -4.523 0.000
medulloblastoma, large-cell 1.100 0.000
interstitial cystitis 1.700 0.037
ovarian cancer -1.600 0.000
psoriasis 1.300 0.000

Synonym

Accession Q96H15 B5MCL9 TIMD-4
Symbols TIM4
SMUCKLER

Gene

PDB

5DZN   5F7F   5F7H  

Gene RIF (31)

PMID Text
26512878 Data showed up-regulation of TIM-4 in lung cancer tissues and a correlation with poor prognosis. Also, TIM-4 was found to promote growth of lung cancer cells by its interaction with integrin alphavbeta3 through its RGD motif.
25899833 TIM-4 rs7700944 and not TIM-1 rs41297579 G>A (-1454) is associated with rheumatoid arthritis(RA) in the present cohort of Egyptian and may be a risk factor for development of RA in Egyptian.
25359708 Tim-4 expression on monocytes and Tim-4 level in plasma were more highly increased in ankylosing spondylitis patients than in controls.
25136083 Our study uncovers a novel ability of TIM-family proteins to block the release of HIV-1 and other viruses by interaction with virion- and cell-associated phosphatidylserine.
25136083 TIM-4 inhibits the release of HIV-1 in terms of reduced levels of CA and RT activity in virus particles, and induces the accumulation of cell-associated CA
25136083 TIM-4 inhibits the release of HIV-1 in terms of reduced levels of CA and RT activity in virus particles, and induces the accumulation of cell-associated CA
24768220 Data suggest that genetic polymorphisms in ANGPTL3 (angiopoietin-like 3 protein), TIMD4 (T cell immunoglobulin mucin-4), and apolipoproteins A5 and B are among the genetic determinants of hypertriglyceridemia in Amerindian populations. [REVIEW]
24286866 TIM-1 and TIM-4 are novel targets for ADAM10- and ADAM17-mediated ectodomain shedding.
24217665 Our results do not support an association between the rs7700944 polymorphism of the TIM-4 gene and rheumatoid arthritis
24204099 TIM4 expression is promoted by Cockroach allergen Bla g 7 in dendritic cells leading to Th2 polarization
More...

AA Sequence

MSKEPLILWLMIEFWWLYLTPVTSETVVTEVLGHRVTLPCLYSSWSHNSNSMCWGKDQCPYSGCKEALIR      1 - 70
TDGMRVTSRKSAKYRLQGTIPRGDVSLTILNPSESDSGVYCCRIEVPGWFNDVKINVRLNLQRASTTTHR     71 - 140
TATTTTRRTTTTSPTTTRQMTTTPAALPTTVVTTPDLTTGTPLQMTTIAVFTTANTCLSLTPSTLPEEAT    141 - 210
GLLTPEPSKEGPILTAESETVLPSDSWSSVESTSADTVLLTSKESKVWDLPSTSHVSMWKTSDSVSSPQP    211 - 280
GASDTAVPEQNKTTKTGQMDGIPMSMKNEMPISQLLMIIAPSLGFVLFALFVAFLLRGKLMETYCSQKHT    281 - 350
RLDYIGDSKNVLNDVQHGREDEDGLFTL                                              351 - 378
//

Text Mined References (37)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26512878 2015 TIM-4 promotes the growth of non-small-cell lung cancer in a RGD motif-dependent manner.
25899833 2015 TIM-1 rs41297579 G>A (-1454) and TIM-4 rs7700944 gene polymorphisms as possible risk factor for rheumatoid arthritis: relation to activity and severity.
25359708 2015 Increased expression of T cell immunoglobulin and mucin domain 4 is positively associated with the disease severity of patients with ankylosing spondylitis.
25136083 2014 TIM-family proteins inhibit HIV-1 release.
24768220 2014 Genetic and environmental determinants of the susceptibility of Amerindian derived populations for having hypertriglyceridemia.
24286866 2014 Soluble T cell immunoglobulin and mucin domain (TIM)-1 and -4 generated by A Disintegrin And Metalloprotease (ADAM)-10 and -17 bind to phosphatidylserine.
24217665 2013 Association between the rs7700944 polymorphism in the TIM-4 gene and rheumatoid arthritis in Zahedan, southeast Iran.
24204099 2013 Cockroach allergen Bla g 7 promotes TIM4 expression in dendritic cells leading to Th2 polarization.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
More...