Property Summary

NCBI Gene PubMed Count 41
PubMed Score 95.71
PubTator Score 45.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Ovarian Cysts 41 0.0 0.0
Disease Target Count P-value
psoriasis 6694 4.6e-14
osteosarcoma 7950 3.5e-09
ovarian cancer 8520 6.0e-07
medulloblastoma, large-cell 6241 2.3e-04
interstitial cystitis 2312 3.7e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Lipid metabolism disorder 114 0.0 3.0

Expression

  Differential Expression (5)

Disease log2 FC p
interstitial cystitis 1.700 3.7e-02
medulloblastoma, large-cell 1.100 2.3e-04
osteosarcoma -4.523 3.5e-09
ovarian cancer -1.600 6.0e-07
psoriasis 1.300 4.6e-14

Gene RIF (36)

AA Sequence

MSKEPLILWLMIEFWWLYLTPVTSETVVTEVLGHRVTLPCLYSSWSHNSNSMCWGKDQCPYSGCKEALIR      1 - 70
TDGMRVTSRKSAKYRLQGTIPRGDVSLTILNPSESDSGVYCCRIEVPGWFNDVKINVRLNLQRASTTTHR     71 - 140
TATTTTRRTTTTSPTTTRQMTTTPAALPTTVVTTPDLTTGTPLQMTTIAVFTTANTCLSLTPSTLPEEAT    141 - 210
GLLTPEPSKEGPILTAESETVLPSDSWSSVESTSADTVLLTSKESKVWDLPSTSHVSMWKTSDSVSSPQP    211 - 280
GASDTAVPEQNKTTKTGQMDGIPMSMKNEMPISQLLMIIAPSLGFVLFALFVAFLLRGKLMETYCSQKHT    281 - 350
RLDYIGDSKNVLNDVQHGREDEDGLFTL                                              351 - 378
//

Text Mined References (43)

PMID Year Title