Property Summary

NCBI Gene PubMed Count 9
PubMed Score 7.95
PubTator Score 0.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer -1.200 6.0e-06

Synonym

Accession Q96GY3 A8KAQ1 O14557 Q7Z2T9
Symbols F25965
lin-37
ZK418.4

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (7)

AA Sequence

MFPVKVKVEKSELEMAKARNQLDAVLQCLLEKSHMDRERLDEEAGKTPSDTHNKDCSIAATGKRPSARFP      1 - 70
HQRRKKRREMDDGLAEGGPQRSNTYVIKLFDRSVDLAQFSENTPLYPICRAWMRNSPSVRERECSPSSPL     71 - 140
PPLPEDEEGSEVTNSKSRDVYKLPPPTPPGPPGDACRSRIPSPLQPEMQGTPDDEPSEPEPSPSTLIYRN    141 - 210
MQRWKRIRQRWKEASHRNQLRYSESMKILREMYERQ                                      211 - 246
//

Text Mined References (18)

PMID Year Title