Property Summary

NCBI Gene PubMed Count 23
Grant Count 30
R01 Count 15
Funding $2,453,081.14
PubMed Score 133.92
PubTator Score 28.61

Knowledge Summary

Patent (4,155)

Expression

Gene RIF (13)

PMID Text
26653855 Thus, Fcp1 coordinates Cdk1 and Gwl inactivation to derepress PP2A-B55, generating a dephosphorylation switch that drives mitosis progression.
26616283 Boolean modeling identifies Greatwall/MASTL as an important regulator in the AURKA network of neuroblastoma.
26613407 Thus, GWL is a human oncoprotein that promotes the hyperactivation of AKT via the degradation of its phosphatase, PHLPP, in human malignancies.
25808837 Data show that siRNA knockdown of Forkhead box M1 (FOXM1) or microtubule-associated serine/threonine kinase-like (MASTL) induces radiosensitivity in non-small cell lung cancer (NSCLC).
25472593 data demonstrate that GWL acts in a pathway with PP2A which is essential for prophase I exit and metaphase I microtubule assembly in mouse oocytes.
25373736 Mastl upregulation is involved in cancer progression and tumor recurrence after initial cancer therapy
24391510 Taken together our results suggest a hierarchy of phosphatases coordinating Greatwall, Ensa/ARPP19 and Cdk substrate dephosphorylation during mitotic exit.
22102272 Studies indicate that mutations in three different genes within the THC2 locus have been associated with congenital thrombocytopenia, including a mutation in MASTL.
21444715 results identify Gwl as a member of the AGC family of kinases that appears to be regulated by unique mechanisms and that differs from the other members of this family
20818157 MASTL enhances cyclin B1-Cdk1-dependent mitotic phosphorylation events, directing mitotic entry, anaphase and cytokinesis in human cells.
More...

AA Sequence

MDPTAGSKKEPGGGAATEEGVNRIAVPKPPSIEEFSIVKPISRGAFGKVYLGQKGGKLYAVKVVKKADMI      1 - 70
NKNMTHQVQAERDALALSKSPFIVHLYYSLQSANNVYLVMEYLIGGDVKSLLHIYGYFDEEMAVKYISEV     71 - 140
ALALDYLHRHGIIHRDLKPDNMLISNEGHIKLTDFGLSKVTLNRDINMMDILTTPSMAKPRQDYSRTPGQ    141 - 210
VLSLISSLGFNTPIAEKNQDPANILSACLSETSQLSQGLVCPMSVDQKDTTPYSSKLLKSCLETVASNPG    211 - 280
MPVKCLTSNLLQSRKRLATSSASSQSHTFISSVESECHSSPKWEKDCQESDEALGPTMMSWNAVEKLCAK    281 - 350
SANAIETKGFNKKDLELALSPIHNSSALPTTGRSCVNLAKKCFSGEVSWEAVELDVNNINMDTDTSQLGF    351 - 420
HQSNQWAVDSGGISEEHLGKRSLKRNFELVDSSPCKKIIQNKKTCVEYKHNEMTNCYTNQNTGLTVEVQD    421 - 490
LKLSVHKSQQNDCANKENIVNSFTDKQQTPEKLPIPMIAKNLMCELDEDCEKNSKRDYLSSSFLCSDDDR    491 - 560
ASKNISMNSDSSFPGISIMESPLESQPLDSDRSIKESSFEESNIEDPLIVTPDCQEKTSPKGVENPAVQE    561 - 630
SNQKMLGPPLEVLKTLASKRNAVAFRSFNSHINASNNSEPSRMNMTSLDAMDISCAYSGSYPMAITPTQK    631 - 700
RRSCMPHQQTPNQIKSGTPYRTPKSVRRGVAPVDDGRILGTPDYLAPELLLGRAHGPAVDWWALGVCLFE    701 - 770
FLTGIPPFNDETPQQVFQNILKRDIPWPEGEEKLSDNAQSAVEILLTIDDTKRAGMKELKRHPLFSDVDW    771 - 840
ENLQHQTMPFIPQPDDETDTSYFEARNTAQHLTVSGFSL                                   841 - 879
//

Text Mined References (35)

PMID Year Title
26653855 2015 Fcp1 phosphatase controls Greatwall kinase to promote PP2A-B55 activation and mitotic progression.
26616283 2016 Boolean modeling identifies Greatwall/MASTL as an important regulator in the AURKA network of neuroblastoma.
26613407 2015 Greatwall promotes cell transformation by hyperactivating AKT in human malignancies.
25808837 2015 Genome-wide siRNA Screen Identifies the Radiosensitizing Effect of Downregulation of MASTL and FOXM1 in NSCLC.
25472593 2014 Role of Greatwall kinase in release of mouse oocytes from diplotene arrest.
25373736 2014 Mastl kinase, a promising therapeutic target, promotes cancer recurrence.
24391510 2014 PP2A/B55 and Fcp1 regulate Greatwall and Ensa dephosphorylation during mitotic exit.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22102272 2011 Thrombocytopenias due to gray platelet syndrome or THC2 mutations.
More...