Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.59
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Expression

Synonym

Accession Q96GE6 B4DL15 F8W6Y4 Q6MZY3 Q6N048 Q9H286
Symbols NY-BR-20

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

AA Sequence

MAAEHLLPGPPPSLADFRLEAGGKGTERGSGSSKPTGSSRGPRMAKFLSQDQINEYKECFSLYDKQQRGK      1 - 70
IKATDLMVAMRCLGASPTPGEVQRHLQTHGIDGNGELDFSTFLTIMHMQIKQEDPKKEILLAMLMVDKEK     71 - 140
KGYVMASDLRSKLTSLGEKLTHKEVDDLFREADIEPNGKVKYDEFIHKITLPGRDY                  141 - 196
//

Text Mined References (8)

PMID Year Title
23377640 2013 Common genetic variation and antidepressant efficacy in major depressive disorder: a meta-analysis of three genome-wide pharmacogenetic studies.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12747765 2001 Humoral immunity to human breast cancer: antigen definition and quantitative analysis of mRNA expression.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.