Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.59
PubTator Score 0.25

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MAAEHLLPGPPPSLADFRLEAGGKGTERGSGSSKPTGSSRGPRMAKFLSQDQINEYKECFSLYDKQQRGK      1 - 70
IKATDLMVAMRCLGASPTPGEVQRHLQTHGIDGNGELDFSTFLTIMHMQIKQEDPKKEILLAMLMVDKEK     71 - 140
KGYVMASDLRSKLTSLGEKLTHKEVDDLFREADIEPNGKVKYDEFIHKITLPGRDY                  141 - 196
//

Text Mined References (8)

PMID Year Title