Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.77
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
osteosarcoma -1.582 0.000
juvenile dermatomyositis 3.435 0.000
Atopic dermatitis 1.900 0.014
tuberculosis 1.200 0.000
non-small cell lung cancer 1.050 0.000
interstitial cystitis 3.900 0.007
primary Sjogren syndrome 1.900 0.000
psoriasis 4.000 0.000
breast carcinoma 1.300 0.000
ductal carcinoma in situ 1.600 0.032
invasive ductal carcinoma 1.900 0.004
ovarian cancer 1.200 0.000

Gene RIF (1)

PMID Text
20372783 Hs.137007 gene is a novel gene specifically expressed in the breast that has a role in epigenetic regulation of breast cancer [Hs.137007]

AA Sequence

MVLRSHPFPRQDRPQGSVPRAVPGSPVGPSTSTHSEDRHGPSSSVGTVIGTGTGGLVEAGGQPQPRSSET      1 - 70
NGSPSPDPPPGLRGEGTREKSLDPLPQAAMPRGPAQPPAQRPPGPAASSSARRSQPVPQLRKRSRCEIAP     71 - 140
SSEQEVRPAASGDPQGEAPGEGGSPAGRSGALTEKQEEARKLMVFLQRPGGWGVVEGPRKPSSRALEPAT    141 - 210
AAALRRRLDLGSCLDVLAFAQQHGEPGLAQETYALMSDNLLRVLGDPCLYRRLSAADRERILSLRTGRGR    211 - 280
AVLGVLVLPSLYQGGRSGLPRGPRGEEPPAAAPVSLPLPAHLHVFNPRENTWRPLTQVPEEAPLRGCGLC    281 - 350
TMHNYLFLAGGIRGSGAKAVCSNEVFCYNPLTNIWSQVRPMQQARAQLKLVALDGLLYAIGGECLYSMEC    351 - 420
YDPRTDAWTPRAPLPAGTFPVAHEAVACRGDIYVTGGHLFYRLLRYSPVKDAWDECPYSASHRRSSDIVA    421 - 490
LGGFLYRFDLLRGVGAAVMRYNTVTGSWSRAASLPLPAPAPLHCTTLGNTIYCLNPQVTATFTVSGGTAQ    491 - 560
FQAKELQPFPLGSTGVLSPFILTLPPEDRLQTSL                                        561 - 594
//

Text Mined References (6)

PMID Year Title
20372783 2010 Hs.137007 is a novel epigenetic marker hypermethylated and up-regulated in breast cancer.
20139978 2010 Genome-wide association study of hematological and biochemical traits in a Japanese population.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10591208 1999 The DNA sequence of human chromosome 22.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.