Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.25
PubTator Score 1.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
glioblastoma -1.100 0.008
medulloblastoma, large-cell -1.100 0.001
active Crohn's disease 1.112 0.018
adult high grade glioma -1.100 0.011
ovarian cancer 2.100 0.000

Gene RIF (1)

PMID Text
19680650 The association between Yo and CCDC104 antibodies in paraneoplastic neurological syndromes may indicate functional similarities.

AA Sequence

MAAEEEDEVEWVVESIAGFLRGPDWSIPILDFVEQKCEVFDDEEESKLTYTEIHQEYKELVEKLLEGYLK      1 - 70
EIGINEDQFQEACTSPLAKTHTSQAILQPVLAAEDFTIFKAMMVQKNIEMQLQAIRIIQERNGVLPDCLT     71 - 140
DGSDVVSDLEHEEMKILREVLRKSKEEYDQEEERKRKKQLSEAKTEEPTVHSSEAAIMNNSQGDGEHFAH    141 - 210
PPSEVKMHFANQSIEPLGRKVERSETSSLPQKDLKIPGLEHASIEGPIANLSVLGTEELRQREHYLKQKR    211 - 280
DKLMSMRKDMRTKQIQNMEQKGKPTGEVEEMTEKPEMTAEEKQTLLKRRLLAEKLKEEVINK            281 - 342
//

Text Mined References (11)

PMID Year Title
26455799 2015 The Interaction of CCDC104/BARTL1 with Arl3 and Implications for Ciliary Function.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22085962 2011 An ARL3-UNC119-RP2 GTPase cycle targets myristoylated NPHP3 to the primary cilium.
19680650 2010 Antibody to CCDC104 is associated with a paraneoplastic antibody to CDR2 (anti-Yo).
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...