Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.25
PubTator Score 1.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 1.08052123317584E-6
medulloblastoma, large-cell 6234 8.88382251552176E-4
glioblastoma 5572 0.00783206633074432
adult high grade glioma 2148 0.0109704915316651
active Crohn's disease 918 0.0182242672885363
Disease Target Count Z-score Confidence
cone-rod dystrophy 60 3.868 1.9

Expression

  Differential Expression (5)

Disease log2 FC p
glioblastoma -1.100 0.008
medulloblastoma, large-cell -1.100 0.001
active Crohn's disease 1.112 0.018
adult high grade glioma -1.100 0.011
ovarian cancer 2.100 0.000

Synonym

Accession Q96G28 Q53SF0 Q53ST9 Q6UY34
Symbols BARTL1
CCDC104

Gene

PANTHER Protein Class (2)

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Platypus OMA EggNOG
Xenopus OMA EggNOG
Zebrafish OMA EggNOG
Fruitfly EggNOG Inparanoid

Pathway (1)

Gene RIF (1)

PMID Text
19680650 The association between Yo and CCDC104 antibodies in paraneoplastic neurological syndromes may indicate functional similarities.

AA Sequence

MAAEEEDEVEWVVESIAGFLRGPDWSIPILDFVEQKCEVFDDEEESKLTYTEIHQEYKELVEKLLEGYLK      1 - 70
EIGINEDQFQEACTSPLAKTHTSQAILQPVLAAEDFTIFKAMMVQKNIEMQLQAIRIIQERNGVLPDCLT     71 - 140
DGSDVVSDLEHEEMKILREVLRKSKEEYDQEEERKRKKQLSEAKTEEPTVHSSEAAIMNNSQGDGEHFAH    141 - 210
PPSEVKMHFANQSIEPLGRKVERSETSSLPQKDLKIPGLEHASIEGPIANLSVLGTEELRQREHYLKQKR    211 - 280
DKLMSMRKDMRTKQIQNMEQKGKPTGEVEEMTEKPEMTAEEKQTLLKRRLLAEKLKEEVINK            281 - 342
//

Text Mined References (11)

PMID Year Title
26455799 2015 The Interaction of CCDC104/BARTL1 with Arl3 and Implications for Ciliary Function.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22085962 2011 An ARL3-UNC119-RP2 GTPase cycle targets myristoylated NPHP3 to the primary cilium.
19680650 2010 Antibody to CCDC104 is associated with a paraneoplastic antibody to CDR2 (anti-Yo).
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...