Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.26
PubTator Score 1.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 2.1e-04
medulloblastoma, large-cell 6241 8.9e-04
glioblastoma 5792 7.8e-03
adult high grade glioma 3801 1.1e-02
active Crohn's disease 922 1.8e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
cone-rod dystrophy 59 3.707 1.9

Expression

  Differential Expression (5)

Disease log2 FC p
active Crohn's disease 1.112 1.8e-02
adult high grade glioma -1.100 1.1e-02
glioblastoma -1.100 7.8e-03
medulloblastoma, large-cell -1.100 8.9e-04
ovarian cancer -1.300 2.1e-04

Gene RIF (1)

AA Sequence

MAAEEEDEVEWVVESIAGFLRGPDWSIPILDFVEQKCEVFDDEEESKLTYTEIHQEYKELVEKLLEGYLK      1 - 70
EIGINEDQFQEACTSPLAKTHTSQAILQPVLAAEDFTIFKAMMVQKNIEMQLQAIRIIQERNGVLPDCLT     71 - 140
DGSDVVSDLEHEEMKILREVLRKSKEEYDQEEERKRKKQLSEAKTEEPTVHSSEAAIMNNSQGDGEHFAH    141 - 210
PPSEVKMHFANQSIEPLGRKVERSETSSLPQKDLKIPGLEHASIEGPIANLSVLGTEELRQREHYLKQKR    211 - 280
DKLMSMRKDMRTKQIQNMEQKGKPTGEVEEMTEKPEMTAEEKQTLLKRRLLAEKLKEEVINK            281 - 342
//

Text Mined References (11)

PMID Year Title