Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.30
PubTator Score 6.45

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q96G27 B2RE02 O95637 WBP-1
Symbols WBP-1

Gene

PDB

1JMQ   1K5R  

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG Inparanoid

 GO Function (1)

 Compartment GO Term (1)

Gene RIF (2)

AA Sequence

MARASSGNGSEEAWGALRAPQQQLRELCPGVNNQPYLCESGHCCGETGCCTYYYELWWFWLLWTVLILFS      1 - 70
CCCAFRHRRAKLRLQQQQRQREINLLAYHGACHGAGPFPTGSLLDLRFLSTFKPPAYEDVVHRPGTPPPP     71 - 140
YTVAPGRPLTASSEQTCCSSSSSCPAHFEGTNVEGVSSHQSAPPHQEGEPGAGVTPASTPPSCRYRRLTG    141 - 210
DSGIELCPCPASGEGEPVKEVRVSATLPDLEDYSPCALPPESVPQIFPMGLSSSEGDIP               211 - 269
//

Text Mined References (11)

PMID Year Title