Property Summary

NCBI Gene PubMed Count 11
Grant Count 3
R01 Count 3
Funding $151,959.84
PubMed Score 0.30
PubTator Score 6.45

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q96G27 B2RE02 O95637 WBP-1
Symbols WBP-1

Gene

PDB

1JMQ   1K5R  

 GO Function (1)

 Compartment GO Term (0)

Gene RIF (2)

PMID Text
21981024 The WW1 and WW2 domains of YAP2 recognize various PPXY motifs within WBP1 and WBP2 in a highly promiscuous and subtle manner.
21841196 Mcl-1 is a determinant of cell fate, and ATF6 mediates apoptosis via specific suppression of Mcl-1 through up-regulation of WBP1

AA Sequence

MARASSGNGSEEAWGALRAPQQQLRELCPGVNNQPYLCESGHCCGETGCCTYYYELWWFWLLWTVLILFS      1 - 70
CCCAFRHRRAKLRLQQQQRQREINLLAYHGACHGAGPFPTGSLLDLRFLSTFKPPAYEDVVHRPGTPPPP     71 - 140
YTVAPGRPLTASSEQTCCSSSSSCPAHFEGTNVEGVSSHQSAPPHQEGEPGAGVTPASTPPSCRYRRLTG    141 - 210
DSGIELCPCPASGEGEPVKEVRVSATLPDLEDYSPCALPPESVPQIFPMGLSSSEGDIP               211 - 269
//

Text Mined References (11)

PMID Year Title
25283809 2014 Ligand binding to WW tandem domains of YAP2 transcriptional regulator is under negative cooperativity.
21981024 2011 Biophysical analysis of binding of WW domains of the YAP2 transcriptional regulator to PPXY motifs within WBP1 and WBP2 adaptors.
21841196 2011 Activating transcription factor-6 (ATF6) mediates apoptosis with reduction of myeloid cell leukemia sequence 1 (Mcl-1) protein via induction of WW domain binding protein 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15064722 2004 WWOX binds the specific proline-rich ligand PPXY: identification of candidate interacting proteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9202023 1997 Characterization of the WW domain of human yes-associated protein and its polyproline-containing ligands.
9169421 1997 Identification of novel human WW domain-containing proteins by cloning of ligand targets.
More...