Property Summary

NCBI Gene PubMed Count 10
PubMed Score 14.62
PubTator Score 3.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Bladder urothelial carcinoma 4 3.598 1.8

Expression

Gene RIF (2)

AA Sequence

MSFVAYEELIKEGDTAILSLGHGAMVAVRVQRGAQTQTRHGVLRHSVDLIGRPFGSKVTCGRGGWVYVLH      1 - 70
PTPELWTLNLPHRTQILYSTDIALITMMLELRPGSVVCESGTGSGSVSHAIIRTIAPTGHLHTVEFHQQR     71 - 140
AEKAREEFQEHRVGRWVTVRTQDVCRSGFGVSHVADAVFLDIPSPWEAVGHAWDALKVEGGRFCSFSPCI    141 - 210
EQVQRTCQALAARGFSELSTLEVLPQVYNVRTVSLPPPDLGTGTDGPAGSDTSPFRSGTPMKEAVGHTGY    211 - 280
LTFATKTPG                                                                 281 - 289
//

Text Mined References (14)

PMID Year Title