Property Summary

NCBI Gene PubMed Count 8
Grant Count 6
R01 Count 5
Funding $480,208
PubMed Score 14.37
PubTator Score 3.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Bladder carcinoma 3 3.047 1.5

Expression

Synonym

Accession Q96FX7 A6NN78 Q8N7Q9
Symbols GCD14
TRM61
Gcd14p
hTRM61
C14orf172

Gene

PANTHER Protein Class (2)

PDB

5CCB   5CCX   5CD1  

Gene RIF (2)

PMID Text
26470919 The TRM61 heterotetramer is the only active species, both subunits are required for orientating tRNA for catalysis at Trm61.
26234676 we suggest that PKCA tightly controls TRM6/61 activity to prevent translation deregulation that would favor neoplastic development.

AA Sequence

MSFVAYEELIKEGDTAILSLGHGAMVAVRVQRGAQTQTRHGVLRHSVDLIGRPFGSKVTCGRGGWVYVLH      1 - 70
PTPELWTLNLPHRTQILYSTDIALITMMLELRPGSVVCESGTGSGSVSHAIIRTIAPTGHLHTVEFHQQR     71 - 140
AEKAREEFQEHRVGRWVTVRTQDVCRSGFGVSHVADAVFLDIPSPWEAVGHAWDALKVEGGRFCSFSPCI    141 - 210
EQVQRTCQALAARGFSELSTLEVLPQVYNVRTVSLPPPDLGTGTDGPAGSDTSPFRSGTPMKEAVGHTGY    211 - 280
LTFATKTPG                                                                 281 - 289
//

Text Mined References (12)

PMID Year Title
26470919 2015 Crystal Structure of the Human tRNA m(1)A58 Methyltransferase-tRNA(3)(Lys) Complex: Refolding of Substrate tRNA Allows Access to the Methylation Target.
26234676 2016 TRM6/61 connects PKC? with translational control through tRNAi(Met) stabilization: impact on tumorigenesis.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21269460 2011 Initial characterization of the human central proteome.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
16043508 2005 The bipartite structure of the tRNA m1A58 methyltransferase from S. cerevisiae is conserved in humans.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
More...