Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00
PubTator Score 7.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (7)

Disease log2 FC p
breast carcinoma -1.300 7.7e-04
ductal carcinoma in situ -2.100 9.7e-05
group 3 medulloblastoma 1.300 1.3e-04
inflammatory breast cancer -1.500 2.6e-05
invasive ductal carcinoma -2.400 4.7e-04
osteosarcoma 1.489 1.1e-07
ovarian cancer -1.100 6.0e-05

 GO Function (1)

 GO Component (1)

 GO Process (1)

AA Sequence

MASSSPDSPCSCDCFVSVPPASAIPAVIFAKNSDRPRDEVQEVVFVPAGTHTPGSRLQCTYIEVEQVSKT      1 - 70
HAVILSRPSWLWGAEMGANEHGVCIGNEAVWTKEPVGEGEALLGMDLLRLALERSSSAQEALHVITGLLE     71 - 140
HYGQGGNCLEDAAPFSYHSTFLLADRTEAWVLETAGRLWAAQRIQEGARNISNQLSIGTDISAQHPELRT    141 - 210
HAQAKGWWDGQGAFDFAQIFSLTQQPVRMEAAKARFQAGRELLRQRQGGITAEVMMGILRDKESGICMDS    211 - 280
GGFRTTASMVSVLPQDPTQPCVHFLTATPDPSRSVFKPFIFGMGVAQAPQVLSPTFGAQDPVRTLPRFQT    281 - 350
QVDRRHTLYRGHQAALGLMERDQDRGQQLQQKQQDLEQEGLEATQGLLAGEWAPPLWELGSLFQAFVKRE    351 - 420
SQAYA                                                                     421 - 425
//

Text Mined References (12)

PMID Year Title