Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.58
PubTator Score 0.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma 1.200 4.8e-02
Astrocytoma, Pilocytic 1.700 2.3e-10
atypical teratoid / rhabdoid tumor 1.200 5.1e-04
ependymoma 1.100 1.1e-05
gastric carcinoma 1.300 3.0e-02
glioblastoma 1.200 1.9e-06
intraductal papillary-mucinous adenoma (... -1.100 4.8e-04
lung carcinoma -1.200 4.3e-14
medulloblastoma, large-cell -1.400 4.8e-03
oligodendroglioma 1.300 4.4e-02
ovarian cancer 2.100 3.1e-07
pediatric high grade glioma 1.200 2.5e-05
primitive neuroectodermal tumor 1.600 4.6e-05
ulcerative colitis -1.200 3.7e-05

Gene RIF (1)

AA Sequence

MAHIPSGGAPAAGAAPMGPQYCVCKVELSVSGQNLLDRDVTSKSDPFCVLFTENNGRWIEYDRTETAINN      1 - 70
LNPAFSKKFVLDYHFEEVQKLKFALFDQDKSSMRLDEHDFLGQFSCSLGTIVSSKKITRPLLLLNDKPAG     71 - 140
KGLITIAAQELSDNRVITLSLAGRRLDKKDLFGKSDPFLEFYKPGDDGKWMLVHRTEVIKYTLDPVWKPF    141 - 210
TVPLVSLCDGDMEKPIQVMCYDYDNDGGHDFIGEFQTSVSQMCEARDSVPLEFECINPKKQRKKKNYKNS    211 - 280
GIIILRSCKINRDYSFLDYILGGCQLMFTVGIDFTASNGNPLDPSSLHYINPMGTNEYLSAIWAVGQIIQ    281 - 350
DYDSDKMFPALGFGAQLPPDWKVSHEFAINFNPTNPFCSGVDGIAQAYSACLPHIRFYGPTNFSPIVNHV    351 - 420
ARFAAQATQQRTATQYFILLIITDGVISDMEETRHAVVQASKLPMSIIIVGVGNADFAAMEFLDGDSRML    421 - 490
RSHTGEEAARDIVQFVPFREFRNAAKETLAKAVLAELPQQVVQYFKHKNLPPTNSEPA                491 - 548
//

Text Mined References (15)

PMID Year Title