Property Summary

NCBI Gene PubMed Count 23
PubMed Score 12.58
PubTator Score 15.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
esophageal adenocarcinoma -1.500 0.020
posterior fossa group B ependymoma -1.400 0.000
medulloblastoma, large-cell 1.800 0.003
non-small cell lung cancer 1.996 0.000
cystic fibrosis 1.500 0.001
group 3 medulloblastoma 2.600 0.000
pilocytic astrocytoma -1.200 0.000
lung adenocarcinoma 1.600 0.005
lung carcinoma 1.500 0.000
ovarian cancer -1.100 0.001
pituitary cancer -1.100 0.029

Synonym

Accession Q96FL9 B3KV89 Q4ZG75 Q53SU1 Q53TJ0 Q8IVI4 Q9BRH1 Q9H827 Q9H9J8
Symbols GALNT15
GalNac-T10
GalNac-T14

Gene

PANTHER Protein Class (2)

Gene RIF (13)

PMID Text
26871639 GALNT14 genotypes were significantly associated with clinical outcomes of transcatheter arterial chemoembolization.
26544896 Expression of GalNAc-T14 or HOXB9 was strongly correlated with reduced recurrence-free survival in lung adenocarcinomas.
26309160 Recurrence of mutation suggests GALNT14 as a novel gene potentially involved in neuroblastoma predisposition.
24962947 GALNT14 stimulates MMP-2 expression.
23959947 GALN14 genotype (rs9679162) was an effective predictor for therapeutic outcome in advanced hepatocellular carcinoma (HCC) patients treated by FMP chemotherapy.
22441125 Studies demonstrate that IGFBP-3 and GalNAc-T14 are colocalized in MCF-7 cells, and confirmed the interaction between IGFBP-3 and GalNAc-T14; these results reveal a minimal region of GalNAc-T14 that was sufficiently bound to the full-length IGFBP-3.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20356418 Results provide evidence that GalNAc-T14 may be a potential biomarker for breast cancer by immunohistochemistry.
20179215 GALNT14 and FUT3/6 H-scores were significantly higher in non-small cell lung cancer cell lines sensitive to dulanermin and drozitumab versus resistant cell lines
More...

AA Sequence

MRRLTRRLVLPVFGVLWITVLLFFWVTKRKLEVPTGPEVQTPKPSDADWDDLWDQFDERRYLNAKKWRVG      1 - 70
DDPYKLYAFNQRESERISSNRAIPDTRHLRCTLLVYCTDLPPTSIIITFHNEARSTLLRTIRSVLNRTPT     71 - 140
HLIREIILVDDFSNDPDDCKQLIKLPKVKCLRNNERQGLVRSRIRGADIAQGTTLTFLDSHCEVNRDWLQ    141 - 210
PLLHRVKEDYTRVVCPVIDIINLDTFTYIESASELRGGFDWSLHFQWEQLSPEQKARRLDPTEPIRTPII    211 - 280
AGGLFVIDKAWFDYLGKYDMDMDIWGGENFEISFRVWMCGGSLEIVPCSRVGHVFRKKHPYVFPDGNANT    281 - 350
YIKNTKRTAEVWMDEYKQYYYAARPFALERPFGNVESRLDLRKNLRCQSFKWYLENIYPELSIPKESSIQ    351 - 420
KGNIRQRQKCLESQRQNNQETPNLKLSPCAKVKGEDAKSQVWAFTYTQQILQEELCLSVITLFPGAPVVL    421 - 490
VLCKNGDDRQQWTKTGSHIEHIASHLCLDTDMFGDGTENGKEIVVNPCESSLMSQHWDMVSS            491 - 552
//

Text Mined References (24)

PMID Year Title
27124048 2016 GALNT14 Genotype Predicts Postoperative Outcome of Stage III Colorectal Cancer With Oxaliplatin as Adjuvant Chemotherapy.
26871639 2016 GALNT14 genotype effectively predicts the therapeutic response in unresectable hepatocellular carcinoma treated with transcatheter arterial chemoembolization.
26544896 2015 GalNAc-T14 promotes metastasis through Wnt dependent HOXB9 expression in lung adenocarcinoma.
26309160 2015 Identification of GALNT14 as a novel neuroblastoma predisposition gene.
25102180 2014 Meta-analysis of genome-wide association studies in African Americans provides insights into the genetic architecture of type 2 diabetes.
24962947 2015 GALNT14 mediates tumor invasion and migration in breast cancer cell MCF-7.
23959947 2014 A single nucleotide polymorphism on the GALNT14 gene as an effective predictor of response to chemotherapy in advanced hepatocellular carcinoma.
23708057 2013 The mucin-type glycosylating enzyme polypeptide N-acetylgalactosaminyltransferase 14 promotes the migration of ovarian cancer by modifying mucin 13.
22441125 2012 Colocalization and identification of interaction sites between IGFBP-3 and GalNAc-T14.
22174851 2011 Genomewide association study for determinants of HIV-1 acquisition and viral set point in HIV-1 serodiscordant couples with quantified virus exposure.
More...