Property Summary

NCBI Gene PubMed Count 18
PubMed Score 3.77
PubTator Score 4.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
acute myeloid leukemia -1.500 2.7e-02
astrocytic glioma -1.900 7.2e-03
atypical teratoid / rhabdoid tumor -1.900 2.2e-06
chronic lymphosyte leukemia 1.400 6.8e-04
cystic fibrosis 1.100 5.6e-03
glioblastoma -1.700 9.3e-05
group 3 medulloblastoma -1.400 2.1e-02
intraductal papillary-mucinous carcinoma... 1.500 6.0e-04
medulloblastoma, large-cell -1.700 3.6e-03
oligodendroglioma -1.400 4.5e-02
osteosarcoma -1.923 1.0e-05
ovarian cancer -1.100 3.0e-09
pancreatic cancer 1.600 5.1e-03
Pick disease -1.100 7.2e-03
pituitary cancer 1.300 2.1e-05
primary pancreatic ductal adenocarcinoma 1.465 1.0e-02
primary Sjogren syndrome 2.000 3.0e-04
primitive neuroectodermal tumor -1.200 4.1e-02

Gene RIF (6)

AA Sequence

MDQPFTVNSLKKLAAMPDHTDVSLSPEERVRALSKLGCNITISEDITPRRYFRSGVEMERMASVYLEEGN      1 - 70
LENAFVLYNKFITLFVEKLPNHRDYQQCAVPEKQDIMKKLKEIAFPRTDELKNDLLKKYNVEYQEYLQSK     71 - 140
NKYKAEILKKLEHQRLIEAERKRIAQMRQQQLESEQFLFFEDQLKKQELARGQMRSQQTSGLSEQIDGSA    141 - 210
LSCFSTHQNNSLLNVFADQPNKSDATNYASHSPPVNRALTPAATLSAVQNLVVEGLRCVVLPEDLCHKFL    211 - 280
QLAESNTVRGIETCGILCGKLTHNEFTITHVIVPKQSAGPDYCDMENVEELFNVQDQHDLLTLGWIHTHP    281 - 350
TQTAFLSSVDLHTHCSYQLMLPEAIAIVCSPKHKDTGIFRLTNAGMLEVSACKKKGFHPHTKEPRLFSIC    351 - 420
KHVLVKDIKIIVLDLR                                                          421 - 436
//

Text Mined References (22)

PMID Year Title