Property Summary

NCBI Gene PubMed Count 18
PubMed Score 3.76
PubTator Score 4.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Gene RIF (6)

PMID Text
26256234 Catalytic Mechanism of Human AMSH-LP Domain Deubiquitinating Enzymes
22258247 Cellular STAMBPL1 is a positive regulator of human T-cell leukemia virus type 1 Tax-mediated NF-kappaB signaling.
17426287 AMSH redirects CaR from slow recycling to down-regulation, reducing CaR expression and decreasing PTHrP secretion.
16716190 AMSH and AMSH-LP are anchored on the early endosomal membrane via interaction with the clathrin coat
16385451 Observational study of gene-disease association. (HuGE Navigator)
12810066 Data show that associated molecule with the SH3 domain of STAM-like protein (AMSH-LP), unlike AMSH, fails to bind to the SH3 domains of STAM1 (signal transducing adaptor molecule 1) and Grb2.

AA Sequence

MDQPFTVNSLKKLAAMPDHTDVSLSPEERVRALSKLGCNITISEDITPRRYFRSGVEMERMASVYLEEGN      1 - 70
LENAFVLYNKFITLFVEKLPNHRDYQQCAVPEKQDIMKKLKEIAFPRTDELKNDLLKKYNVEYQEYLQSK     71 - 140
NKYKAEILKKLEHQRLIEAERKRIAQMRQQQLESEQFLFFEDQLKKQELARGQMRSQQTSGLSEQIDGSA    141 - 210
LSCFSTHQNNSLLNVFADQPNKSDATNYASHSPPVNRALTPAATLSAVQNLVVEGLRCVVLPEDLCHKFL    211 - 280
QLAESNTVRGIETCGILCGKLTHNEFTITHVIVPKQSAGPDYCDMENVEELFNVQDQHDLLTLGWIHTHP    281 - 350
TQTAFLSSVDLHTHCSYQLMLPEAIAIVCSPKHKDTGIFRLTNAGMLEVSACKKKGFHPHTKEPRLFSIC    351 - 420
KHVLVKDIKIIVLDLR                                                          421 - 436
//

Text Mined References (22)

PMID Year Title
26256234 2015 Quantum Mechanics and Molecular Mechanics Study of the Catalytic Mechanism of Human AMSH-LP Domain Deubiquitinating Enzymes.
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22258247 2012 An RNA interference screen identifies the Deubiquitinase STAMBPL1 as a critical regulator of human T-cell leukemia virus type 1 tax nuclear export and NF-?B activation.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21163940 2011 Interactome mapping suggests new mechanistic details underlying Alzheimer's disease.
19946888 2010 Defining the membrane proteome of NK cells.
18758443 2008 Structural basis for specific cleavage of Lys 63-linked polyubiquitin chains.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...